Conserved Protein Domain Family
PHA03247

?
PHA03247: PHA03247 
large tegument protein UL36; Provisional
Statistics
?
PSSM-Id: 223021
View PSSM: PHA03247
Aligned: 5 rows
Threshold Bit Score: 4070.65
Threshold Setting Gi: 83722605
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30984464     1 MAQRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGSDPPRMCSA 80  
9629306     11 MKRQGDRDIVVTGVRNQFATDLEPGGSVSCMRSSLSFLSLLFDVGPRDVLSAEAIEGCLVEGGEWTRAAAGSGPPRMCSI 90  
56694759     1 MAPRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGGAPPRMCSV 80  
83722605     1 MAPRGDRGIVVTGARNQFAPDLEPGGAVSCMRSSLSFLSLVFDAGLRDALSAEAVDGCLVEGGAWTRASAGGGPPRMCSA 80  
155041490   11 MERGGDRDIVVTGARNQFAPDLEPGGSVSCMRSSLSFLSLIFDVGPRDVLSAEAIEGCLVEGGEWTRATAGPGPPRMCSI 90  
30984464    81 VELPTFLEYPSGR-GLRCVFSRLYGEVAFFGKPAPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDEAYL 159 
9629306     91 IELPNFLEYPAARgGLRCVFSRVYGEVGFFGEPTAGLLETQCPAHTFFAGPWAMRPLSYTLLTIGPLGMGLYRDGDTAYL 170 
56694759    81 VELPTFLEYPSGR-GLRCVFSRVYGEVAFFGQPSPGLLETQCPAHDFFAGPWARRPLSYTLVTIGALGMGLYRDGDDAYL 159 
83722605    81 VELPTFLEYPSGR-GLRCVFSRVYGEVAFFGKPSPGLLETQCPAHDFFAGPWARRPLSYTLVTVGALGMGLYRDGDDAYL 159 
155041490   91 VELPNFLEYPGARgGLRCVFSRVYGEVGFFGEPAAGLLETQCPAHTFFAGPWALRPLSYTLLTIGPLGMGLFRDGDTAYL 170 
30984464   160 FDPHGLREGSPAFVAKIRAGEVYTYLTYYTQEHPEARWAGAMVFFVPAGPGPPATAALTAAVLQLYGASETYLQDEPFVE 239 
9629306    171 FDPHGLPAGTPAFIAKVRAGDVYPYLTYYAHDRPKVRWAGAMVFFVPSGPGAVAPADLTAAALHLYGASETYLQDEPFVE 250 
56694759   160 FDPHGLREGSPAFVAKVRAGEVYTYLTYYTQEHPEARWAGAMVFFVPWGPEPATPAGLAAAALRLYGASETYLQDEPFVE 239 
83722605   160 FDPHGLREGSPAFVAKVRAGEVYTYLTYYTQAHPEARWAGAMVFFVPSGPGPATPAALAAAVLQLYGASETYLQDEPFVE 239 
155041490  171 FDPHGLPEGTPAFIAKVRAGDMYPYLTYYTRDRPDVRWAGAMVFFVPSGPEPAAPADLTAAALHLYGASETYLQDEAFSE 250 
30984464   240 RRVVVSHPLRGDD-------------------------VAPAGAVAVGEEAGRAPAAARKAPPQTPPPKAAAPEpa---- 290 
9629306    251 RRVAITHPLRGEIgglgalfvgvvp-rgdgegsgpvvpALPAPTHVQTPGADRPPEAPRGASGPPDTPQAGHPN------ 323 
56694759   240 RRAVASHPLRGD--------------------------DVPGTPPV-GEGGGGTPGTARGATSRPPPPEPSAPAdpg--- 289 
83722605   240 RDVVASHPLRGD--------------------------DVPGATVLVGGGAVRPPGPARPATPKAPSPRPAPPAappaaa 293 
155041490  251 RRVAITHPLRGEIaglgepcvgvgpregvggpgphpptAAQSPPPTRARRDDRASETSRGTAGPSAKPEAKRPN------ 324 
30984464   291 --------gAADAGVWGAALAGAPLALPAP-------------APSDS------AGGDDAEDDEDGAMEV-VSPLPRPNQ 342 
9629306    324 ---------RPPDDVWAAALEGTPPAKPSApdaaasgpphaapPPQTP------AGDAAEEAEDLRVLEVgAVPVGRHRA 388 
56694759   290 -------paAPPSGVWGAALAGAPLALPAPpp----------sSDSAP------ATDVDDTDGEDGAMEV-VSPLPHPKQ 345 
83722605   294 aeptapgaaAPSPGVWGAALAGAPLALPAPp-----------rPDPAP------ADDPEDADGEDGAMEV-VSPLPHPNQ 355 
155041490  325 ---------RAPDDVWAVALKGTPPTDPPSadppsadppsaipPPPPSapktpaAEAAEEDDDDMRVLEMgVVPVGRHRA 395 
30984464   343 HYPLGFSKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRSARHAATPFSRgsggdeqtrpaagprpptpasrpPTPGA 422 
9629306    389 RYSTGLPKRRRPTWTPPSSVEDLTSGERPAPKAPPAKAKKKSAPKKKAPVAA-----------------------EVPAS 445 
56694759   346 HYPLGFPKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRTRRAARHAASPFARgpgggd-----------qprpstPTPAP 414 
83722605   356 HYPLGFSKRRRPTWTPPSSLEDLSAGRHHPKRASLPTRARRAARHAASPFARgtggdd-----------qtrpaaPAPAS 424 
155041490  396 RYSAGLPKRRRPTWTPPSSVEDLTSGEKTKRSAPPAKTKKKSTPKGKTPVGA-----------------------AVPAS 452 
30984464   423 PPTPgapptpgapptpgapptpagpttassepptpagpttassepptpagpttassepptpagrppTPAGRPPTPANPTA 502 
9629306    446 SPTP--------------------------------------------------------------IAATVPPAPDTPPQ 463 
56694759   415 APVPvpa--------------------------------------------------------ttpAPAPAPLPTADPLP 438 
83722605   425 TPAPtpapgstpappstpasapastap-----------------sgpatpaptsapapspptlapgGPAAQPRPPETPLP 487 
155041490  453 VPEP--------------------------------------------------------------VLASAPPDPAGP-P 469 
30984464   503 SSEPPTPAGRPPTpagrpptpanptassepptpnpegapapssneqppaaastdeATQKALDALRDRQPPEPPCGSLTEL 582 
9629306    464 SGQGGGDDGPASP------------------------------------------SSPSVLETLGARRPPEPPGADLAQL 501 
56694759   439 AADPASSESPAPPperqpaadatep------------------vpddatepapddATRKALDALRERRPPEPPACDPAEL 500 
83722605   488 TPTPDSGESPAPPpepqpprpaa-----------------------daaepapddATRKALDALRERRPPEPPTGGLAEL 544 
155041490  470 VAEAGEDDGPTVP------------------------------------------ASSQALEALKTRRSPEPPGADLAQL 507 
30984464   583 LGRHPDTDGGVSRLAAHEAGIAREVTECSRLTINALRSPFPGSPGLLQHCIVFLFERVLAFLIENGARTHAGAGAEGPAS 662 
9629306    502 FEVHPNVAATAVRLAARDAALAREVAACSQLTINALRSPYPAHPGLLELCVIFFFERVLAFLIENGARTHTQAGVAGPAA 581 
56694759   501 LGRYPDTGGVVSRLAEREVTIAREVAECSRLTVNALRSPFPDAPGLLQHCIILLFERVLAFLIENGARTHAGAGAEGPAS 580 
83722605   545 LGRHPDTGGAVARLAEREATIGREVAECSRLTVNALRSPFPDAPGLLQHCVVLLFERVLAFLIENGARTHAGAGAEGPAA 624 
155041490  508 FEAHPNVAATAVKFTACSAALAREVAACSRLTISALRSPYPASPGLLELCVIFFFERVLAFLIENGARTHTQAGVAGPAA 587 
30984464   663 GLLDLTVSLLPRRTAVGDFLASTRMTLADVAAHLPLIQPVLDEGSIVGRLALAKLVLVARDVIRTTDDFHGELAELERRL 742 
9629306    582 ALLDFTLRMLPRKTAVGDFLASTRMSLADVAAHRPLIQHVLDENSQIGRLALAKLVLVARDVIRETDAFYGDLADLDLQL 661 
56694759   581 ALLDLTLGLLPNRTAVGDFLASTRMTLADVAAHVPLIQPVIEEGSGVGRLALAKLVLVARDVIRATDELHGELAELERQL 660 
83722605   625 ALLDLTLSLLPSRTAVGDFLASTRMTLADVAAHVPLIQPVLEEGSGVGRLALAKLVLVARDVIRTTDEFHGELAELERRL 704 
155041490  588 ALLEFTLNMLPWKTAVGDFLASTRLSLADVAAHLPLVQHVLDENSLIGRLALAKLILVARDVIRETDAFYGELADLELQL 667 
30984464   743 RATPPTEVYARLSEWLLERSKAGPDTLFAPATPTHPEPLLQRIQALAGFARREEVRAAAEDREVRGALDALARGVDAVAR 822 
9629306    662 RAAPPANLYARLGEWLLERSRAHPNTLFAPATPTHPEPLLHRIQALAQFARGEEMRVEAEAREMREALDALARGVDSVSQ 741 
56694759   661 RATPPTEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARGEEARAAAEDREVRGALDALARSVDAVAR 740 
83722605   705 RETPPPEVYARLSEWLLERSRAGPDTLFAPATPTHPEPLLQRVQALAGFARAEETRAAAEDREVRGALDALARGVGAVAR 784 
155041490  668 RAAPPANLYTRLGEWLLERSQAHPDTLFAPATPTHPEPLLYRVQALAKFARGEEIRVEAEDRQMREALDALARGVDAVSQ 747 
30984464   823 RSGPLTVAAVSPEEP-----GEGGGRPHPLSPEAIRVRLEQLRADGQKAVEGATREYFHRGAVYSAKALLAGDARDRRYH 897 
9629306    742 RAGPLTVMPVPAAPGa----GGRAPCPPALGPEAIQARLEDVRIQARRAIESAVKEYFHRGAVYSAKALQASDSHDCRFH 817 
56694759   741 RGGPLAVA-APEAPG-----GTEDPPPHPLSPQAVRSRLDRVRAEGQKAVEGAVKEYFLRGAVYSAKALLAGDARDRRYH 814 
83722605   785 RSGPLTVAPAPPAAPleppgGSGGPRPQPLSPEAIRVRLEQVRAEGQAAIEGATREYFQRGAAYSAKALLAGDARDRRFH 864 
155041490  748 HAGPLGVMPAPAGAA-----PQGAPRPPPLGPEAVQVRLEEVRTQARRAIEGAVKEYFYRGAVYSAKALQASDNNDRRFH 822 
30984464   898 VASAPVVPVVQLLESLPAFDAHVQEVARRARVPAPPPLATSPPAELLRELVQRGRDLEAPADLAAWLASLGDAAGQGLVV 977 
9629306    818 VASAAVVPMVQLLESLPAFDQHTRDVAQRAALPPPPPLATSPQAILLRDLLQRGQPLDAPEDLAAWLSVLTDAATQGLIE 897 
56694759   815 VASAPVVPVAQLLESLPAFDARVREVAARARVPAPPPLATSPAADLLRELLQRGCDLEAPADLAAWLASLGDAAGQGLVA 894 
83722605   865 VASAPVVPVGQLLESLPAFDARVREVAGRARVPAPPALATSPQAELLRELVQRGRDLEAPADLAAWLASLGDAAGQGLVA 944 
155041490  823 VASAAVVPVVQLLESLPVFDQHTRDIAQRAAIPAPPPIATSPTAILLRDLIQRGQTLDAPEDLAAWLSVLTDAANQGLIE 902 
30984464   978 RKELDELAQAIYKINERTVRRSSGLAELERFEALDAALRGELESEAAFEP-----GGGDGAAAGGLPAETRRLAEDALHQ 1052
9629306    898 RKPLEELARSIHGINDQQARRSSGLAELQRFDALDAALAQQLDSDAAFVPa---tGPAPYVDGGGLSPEATRMAEDALRQ 974 
56694759   895 RKELDELAQAIHKINERVVRRSSGLAELERFEALDAALRRELESEAAFEPaadhaAGGDDAAAGGLAPETRRLAEDALRQ 974 
83722605   945 RKELDELTKAVHQINERAVRRSSGLAELERFEALDAALRRELESEAAFGPa----GAAGDGDAGGPPPETRRLAEDALRQ 1020
155041490  903 RKPLDELARSIRDINDQQARRSSGLAELRRFDALDAALGQQLDSDAAFVPa---pGASPYPDDGGLSPEATRMAEEALRQ 979 
30984464  1053 AKAMAAAKLTDELSPEARERLAARVRAIEAMLEEARARAEAAKAALARFFQKLQGVLRPLPDFGGLRVAPAVLATLRADI 1132
9629306    975 ARAMEAAKMTAELAPEARSRLRERAHALEAMLNDARERAKVAHDAREKFLHKLQGVLRPLPDFVGLKACPAVLATLRASL 1054
56694759   975 AKAMAAAKLTDELSPEARDRLGARARAIEDLLAEARARAEAARAARTRFFQRLQGVLRPLPDFGGLRTAPAVLATLRADL 1054
83722605  1021 AKAMAAAKLTDELSPEARERLAARVRAIEAMLEEARERAEAARAARARFFQKLQGVLRPLPDFGGLRVAPAVLATLRADL 1100
155041490  980 ARAMDAAKLTAELAPDARARLRERARSLEAMLEGARERAKVARDAREKFLHKLQGVLRPLPDFVGLKACPAVLATLRASL 1059
30984464  1133 PGGWTCLPDAAQAAPPEVRAALRADLWGLLGQYRGALEHPTADTAAALSGLHPNFAEVLRDLFPAAPETPLLVSFFSDHA 1212
9629306   1055 PAGWTDLADAVRGPPPEVTAALRADLWGLLGQYREALEHPTPDTATALAGLHPAFVVVLKTLFADAPETPVLVQFFSDHA 1134
56694759  1055 PGGWTCLPDAAQAAPPEVRAALRADLWGLLGQYRAALEHPTPDTAAALSGLHPNFVEALRDLFPAAPETPLLVSFFSDHA 1134
83722605  1101 PGGWTGLPEAAQAAPPEARAALRADLWGLLGQYREALEHPTPDTATALSGLHPNFAEVLRELFPAAPETPLLVRFFSDHA 1180
155041490 1060 PAGWSDLPEAVRGAPPEVTAALRADMWGLLGQYRDALEHPTPDTATALSGLHPSFVVVLKNLFADAPETPFLLQFFADHA 1139
30984464  1213 PRVAQAVSEAIAAGSAAVATASPESTVEAAVRAQGVLADTVAALSPAVRDPACPLAFLVALADSAAGYVKATRLALGARR 1292
9629306   1135 PTIAKAVSNAINAGSAAVATASPAATVDAAVRAHGALADAVSALGAAARDPASPLSFLAVLADSAAGYVKATRLALEARG 1214
56694759  1135 PRVARAVSEAINAGGAAVATASPESTVEAAARARDVLAAAVAALSPAVLDPACPLAFLVALADSAAGYERATRLALDARR 1214
83722605  1181 PRLTRAVSEAIAAGSAAVATASPESTAGAAATARAVLAETVAALSPAVLDPACPLAFLVALADSAAGYEKAARLALDARR 1260
155041490 1140 PIIAHAVSNAINAGSAAVATADPASTVDAAVRAHRVLVDAVTALGAAASDPASPLAFLAAMADSAAGYVKATRLALDARV 1219
30984464  1293 AIARLGALGAAAADLAVAVRRENPQADGDRAALLEAAARAVEAARAGLAACEGEFGGLLHAEGSAGDPSPSGRALQELGK 1372
9629306   1215 AIDELTTLGSAAADLVVQARRACAQPEGDHAALIDAAARATTAARESLAGHEAGFGGLLHAEGTAGDHSPSGRALQELGK 1294
56694759  1215 AIARLGALGAAAADLAAAVRRENPEAEGDRAALLEAAARAVAEARAGLAACEGEFGGLLHAEGSTGDPSPSGRALQELGK 1294
83722605  1261 AIARLGALGAAAADLAVAVRRENPQAEGDRAELLEAAARAVAAAREGLVACEGEFGGLLHAEGSAGDPSPSGRALQELGK 1340
155041490 1220 AIAQLTTLGSAAADLVVQVRRAANQPEGEHASLIQAATRATTGARESLAGHEGRFGGLLHAEGTAGDHSPSGRALQELGK 1299
30984464  1373 VVAATRRRADELEAAAADLAEKLADRDARAGRERWAADVEAALDRVENRAEFDAVELRRLQALAAQNKYNPRDFRKRAEQ 1452
9629306   1295 VIGATRRRADELEAAVADLTAKMAAQRARGSSERWAAGVEAALDRVENRAEFDVVELRRLQALAGTHGYNPRDFRKRAEQ 1374
56694759  1295 VVGATRRRADELEAAAADLAEKLAARRARDSRERWVADVDAALDRVENRAEFDAVELRRLQALAAQSNYNPRDFRKRAER 1374
83722605  1341 VVGATRRRADELEAAAADLAEKIAARDARAGRERWAADVEAALDRVETRAEFDAVELRRLQALAARNGYSPRDFRKRAEQ 1420
155041490 1300 VIGATRRRADELEAATADLREKMAAQRARSSHERWAADVEAVLDRVESGAEFDVVELRRLQALAGTHGYNPRDFRKRAEQ 1379
30984464  1453 ALAANAKTATLALEAAFAFNPYTPENQHHPALPPLAAARRIDWGPAFGAAAETYAEMFRVDTEPLARLLRITGGLLDLAQ 1532
9629306   1375 ALAANAEAVTLALDTAFAFNPYTPENQRHPMLPPLAAIHRLGWSAAFHAAAETYADMFRVDAEPLARLLRIAEGLLEMAQ 1454
56694759  1375 ALAANAETATLALEAAFAFNPYTPENQRHPALPPLAAVHRLDWGPAFGAAAETYAEMFRVDTEPLARLLRLAEGLLALSQ 1454
83722605  1421 ALAANAATATLALEAAFAFNPYTPENQHHPTLPPLAALHRVDWGPAFGAAAETYAEMFRVDTEPLARLLRLAGGLLDLAQ 1500
155041490 1380 ALGTNAKAVTLALETALAFNPYTPENQRHPMLPPLAAIHRIDWSAAFGAAADTYADMFRVDTEPLARLLRLAGGLLERAQ 1459
30984464  1533 AGGGFIDYHEAVSRLAEDLNGVPSLRHYVPFFRRGHAEYLELCDRLDALRADVHRALGGVPLDLAAAAEQTVRLRGDPAA 1612
9629306   1455 AGDGFIDYHEAVGRLADDMTSVPGLRRYVPFFQHGYADYVELRDRLDAIRADVHRALGGVPLDLAAAAEQISAARNDPEA 1534
56694759  1455 AGGGFIDYHEAVSRLAEDLNGVPSLRRYVAFFRRGHAEYLGLCDRLAALRADVHRALGGVPLDLAAAAERTTRLRADPAA 1534
83722605  1501 AGGGFIDYHEAVSRLAEDLNGVPSLRRYVPFFRRGHAEYLELCARLDALRAGVHRALGGVPLDLAAAAEQTVRLRGDPAA 1580
155041490 1460 ANDGFIDYHEAVLHLSEDLGGVPALRQYVPFFQKGYAEYVDIRDRLDALRADARRAIGSVALDLAAAAEEISAVRNDPAA 1539
30984464  1613 AAELVRTGVTLACPSEDALAACVGALERVDQAPVKDTAYAEHVAFVARRDLGEAKDALVRAKQQRAEATDRVTAALREAL 1692
9629306   1535 TAELVRTGVTLPCPSEDALVACAAALERVDQSPVKNTAYAEYVAFVTRQDTAETKDAVVRAKQQRAEATERVMAGLREAL 1614
56694759  1535 AAELVRTGVALACPSEDALAACVGALERVDQTPVKDTAYAEYIAYAARRDLGEAKDALVRAKQQRAEATDRVTAALREAL 1614
83722605  1581 AAELVRTGVALACPSEDALAACVGALERVDQTPVKDSAYAEYVAFVARRDLAEAKDALVRAKQQRAEATDRVTAALREAL 1660
155041490 1540 AAELVRAGVTLPCPSEDALVACVAALERVDQSPVKDTAYAHYVAFVTRQDLADTKDAVVRAKQQRAEATERVTAGLREVL 1619
30984464  1693 AAHERQARSEAESLANLKTLLRVAAIPAAAAKTLEQARSVAEIVDQIELLLEQTEKAAELDQAAVDWLEHARRVFEAHPL 1772
9629306   1615 AARERRAQIEAEGLANLKTMLKVVAVPATVAKTLDQARSVAEIADQVEVLLDQTEKTRELDVPAVIWLEHAQRTFETHPL 1694
56694759  1615 AAHERRAQSEAESLANLKTLLRVAAIPATAAKTLDQARSVPEIVDQIELLLEQTEKAAELDPGAVDWLEHARRVFGAHPL 1694
83722605  1661 AAHERQARSEAESLANLKTLLRVAAIPAAAAKTLDQARSVPEIVDQIELLLEQTEKAAELDSAAVDWLEHARRVFEAHPL 1740
155041490 1620 AARERRAQLEAEGLANLKTLLKVVAVPATVAKTLDQARSAEEIADQVEILVDQTEKARELDVQAVAWLEHAQRTFETHPL 1699
30984464  1773 TAARDGSPDPLARLHARLDALGETRRRTAALRRSLEAAEAEWDEVWARFGRARGGAWKSPEALGAAREQLRALQTATNTV 1852
9629306   1695 SAARGDGPGPLARHAGRLGALFDTRRRVDALRRSLEEAEAEWDEVWGRFGRVRGGAWKSPEGFRAMHEQLRALQDTTNTV 1774
56694759  1695 TAARDGAPDPLARLHGRLDALGEACRRTTALRRSLEAAAAEWDEVWVRFGRVRGGAWKSPAALEAAREQLCALRTATNTV 1774
83722605  1741 TAAREGAPDPLARLHERLDALGETRRRTSALRRSLEAAEGEWDEVWARFGRARGGAWKSPEALAAAREQLLALQTATNTV 1820
155041490 1700 SAASGDGPGLLTRQGARLQALFDTRRRVEALRRSLEEAEAEWDEVWGRFGRVRGGAWKSPEGFRAACEQLRALQDTTNTV 1779
30984464  1853 LGLVADAHYPRLPAKYQGAIGAKSAERAGAVEELGVAVERHDGLLARLREDVVARVPWEMNADALGRLLAEFDALAEDLT 1932
9629306   1775 SGLRAQPAYERLSARYQGVLGAKGAERAEAVEELGARVTKHTALCARLRDEVVRRVPWEMNFDALGGLLAEFDAAAADLA 1854
56694759  1775 LGLMADAHYPRLPAKDRGALGAKSAERAGAVEEMGVAVARHDGLLARLREEVVARVPWEMNADALGRLLVEFDALAGDLP 1854
83722605  1821 LGLVADAHYGRLPARYRGAVGAKTAERAGAVEELGAAVARHDGLLARLREEVVGRVPWEMNADALGRLLAEFDALAKDLT 1900
155041490 1780 SGLRAQRDYERLPAKYQGVLGAKSAERAGAVEELGGRVAQHADLSARLRDEVVPRVAWEMNFDTLGGLLAEFDAVAGDLA 1859
30984464  1933 PWAVDEFRGARALVQHRLGLYSAYAKARAQTGAGGTPPpaPAPLLVDVRALEARAR--SPGERHEPDPRTVRGRGEAYLR 2010
9629306   1855 PWAVEEFRGARELIQYRMGLYSAYARAGGQTGAGAESA--PAPLLVDLRALDARARasSSPEGHEVDPQLLRRRGEAYLR 1932
56694759  1855 PWAVDEFRGARALVQHRLGLYSAYAAARAHRGAGGPPP--PAPLLADIRALEARAQ--SPDERRAPDLRMVRCRGEAYLR 1930
83722605  1901 PWAVDEFRGARALVQHRLGLYSAYAKARAHTGAGGGAP--PAPLLVDVRALEARAR--RPGERHEPDPRAVRSRGEAYLR 1976
155041490 1860 PWAVEEFRGARELIQRRMGLYSAYAKATGQTGAGAAAA--PAPLLVDLRALDARARa-SAPPGQEADPQMLRRRGEAYLR 1936
30984464  2011 ARGDPGPLELREATSDLDLPFATSYLTPDGTPLQYVVCFPAVTDKLGALLMRAEAARARPPLPPEGLDSTQTLAAMCTVP 2090
9629306   1933 AGGDPGPLVLREAVSALDLPFATSFLAPDGTPLQYALCFPAVTDKLGALLMRPEAACVRPPLPTDVLESAPTVTAMYVLT 2012
56694759  1931 ASGDPGPLELREATSELDLPFAISYLAPDGTPLQYALCFPAVTDKLGALLMRPEAARARPALPSEGLEATQTLAAMCTVP 2010
83722605  1977 ASGDPGPLELREATSELDLPFATSYLTPDGTPLQYALCFPAVTDKLGALLMRPEAARARPPLPPEGLESTQTLAAMCTVP 2056
155041490 1937 VSGGPGPLVLREATSTLDRPFAPSFLVPDGTPLQYALCFPAVTDKLGALLMCPEAACIRPPLPTDTLESASTVTAMYVLT 2016
30984464  2091 LITQLQLALSDAQGDGFRLFGRFVRHRQPGWRDSAAAAAELYAALTATTLTREFGCRWDELGWERGAPAPAPLAEPAGTR 2170
9629306   2013 VVNRLQLALSDAQAANFQLFGRFVRHRQATWGASMDAAAELYVALVATTLTREFGCRWAQLGWASGAAAPRPPPGPRGSQ 2092
56694759  2011 LITHLQLALSDAQGDGFRLFGRFVRHRQPAWRDSVAAAAELYAALVATTLTREFGCRWDELGWARGEGALAPLAEPAGAR 2090
83722605  2057 LITHLQLALSDAQGEGFRLFGRFVRHRQPAWRDSVAAAAELYAALAATTLTREFGCRWDELGWARGEGALAPLAEPAGAR 2136
155041490 2017 VINRLQLALSDAQAANFQLFGRFVRHRQARWGASMDAAAELYVALVATTLTREFGCRWAQLEWGGDAAAPGPPLGPQSST 2096
30984464  2171 RPRVTFNMNDVMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGAILFVQRLTPHPSPEVRVLPAVAAGPPPA 2250
9629306   2093 RHCVAFNENDVLVALVAGVPEHIYNFWRLDLVRQHEYMHLTLERAFEDAAESMLFVQRLTPHPDARIRVLPTFLDGGPPT 2172
56694759  2091 RPRVTFSINDLMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGAILFVQRLTPHARPEVRVLPAVPAGPPPA 2170
83722605  2137 RPRVTFSINDLMVALVAGTPEHIYNFWRLDLVLQHEYMHLTLPAAWETGAGTILFVQRLTPHARPEVRVLPAVPAGPPPA 2216
155041490 2097 RHRVSFNENDVLVALVASSPEHIYTFWRLDLVRQHEYMHLTLPRAFQNAADSMLFVQRLTPHPDARIRVLPAFSAGGPPT 2176
30984464  2251 TGLLFGTRLADWRHGKLSSSDPLAPWRAAPELAAG-GAAAALGGLGGPRALVAVSVLGRMCLPSAALAALWSCMFPEGYS 2329
9629306   2173 RGLLFGTRLADWRRGKLSETDPLAPWRSALELGTQrRDVPALGKLSPAQALAAVSVLGRMCLPSAALAALWTCMFPDDYT 2252
56694759  2171 TGLLFGTRLADWRHGKLSPSDPLAPWRAAPELAAG-GAAAALGGLDGPRALVAVSVLGRMCLPSAALAALWSCMFPDGYS 2249
83722605  2217 TGLLFGTRLADWRHGKLSPSDPLAPWRAAPELAAG-GAAAALGGLDGPRALVAVSVLGRMCLPSAALAALWSCMFPDGYS 2295
155041490 2177 RGLMFGTRLADWRRGKLSETDPLAPWRSVPELGTErG--AALGKLSPAQALAAVSVLGRMCLPSTALVALWTCMFPDDYT 2254
30984464  2330 EYDSLDALLAARLGAGRPPDPQGGREDVPAPPAHALYRPSGQRVLVRGGAPD--PAARVTVMDLVLAATLLGAPVVVALR 2407
9629306   2253 EYDSFDALLAARLESGQTLGPAGGREASLPEAPHALYRPTGQHVAVLAAATHrtPAARVTAMDLVLAAVLLGAPVVVALR 2332
56694759  2250 EYDSLDALLEARLGSGRAPDPQGGREDAPAPPAHALYRPSGQRVLVRGGPPD--PAARVTVMDLVLAATLLGAPVVVALR 2327
83722605  2296 EYDSLDALLEARLGSGRAPDPQGGREDAPAPPAHALYRPSGQRVLVRGGPPD--PAARVTVMDLVLAATLLGAPVVVALR 2373
155041490 2255 EYDSFDALLTARLESGQTLSPSGGREASPPAPPNALYRPTGQHVAVPAAATHrtPAARVTAMDLVLAAVLLGAPVVVALR 2334
30984464  2408 SDPAFSKGSELELCVTLFDSRERGADAALREVVSSDVETWATDLLHADLNAIENACLAAQLPALSALIAARPLAGSPPCL 2487
9629306   2333 NTTAFSRESELELCLTLFDSRPGGPDAALRDVVSSDIETWAVGLLHTDLNPIENACLAAQLPRLSALIAERPLADGPPCL 2412
56694759  2328 SDPAFSEGSELELCVTLFDSRAGAADAALREVVSSDVETWAADLMHADPNVIENACLAAQLPALSALVAARPLAGSPPCL 2407
83722605  2374 SDPAFSEGSELELCVTLFDSRARAADAALREVVSADVETWATDLLHADLNAIENACLAAQLPALSALVAARPLARSPPCL 2453
155041490 2335 NTTAFSRESELELCLTLFDSRARGPDAALRDAVSSDIETWAVRLLHADLNPIENACLAAQLPRLSALIAERPLARGPPCL 2414
30984464  2488 VLVDISMAPLFVLWEQPDPPGPPDVRFVGSDEIEELPFVSPGADVLAGLAAEGDPFFARTILGAPFSLSRLLHETFPGAP 2567
9629306   2413 VLVDISMTPVAVLWEAPEPPGPPDVRFVGSEATEELPFVATAGDVLAASAADADPFFARAILGRPFDASLLTGELFPGHP 2492
56694759  2408 VIVDISMAPLFVLWERPDPPGPPDVRFVGGEEIEELPFVSPGVEVLAGLAAKDDPFFARTILGAPFSLSHLLREAFPGAP 2487
83722605  2454 VIVDISMAPLFVLWEQPDPPGPPDVRFVGSDEIEELPFVSPGGDVLAGLAAEGDPFFAQTILGAPFSLSRLLREAFPGAP 2533
155041490 2415 VLVDISMTPVAVLWENPDPPGPPDVRFVGSEATEELPFVAGGEDVLAASATDEDPFLARAILGRPFDASLLSGELFPGHP 2494
30984464  2568 VHRRP-PEARFPFAAGAGPDP-------GGGAPPDPEAPPP----PSHQTPAILPDEPVGETVHPRMLTWIRGLEELASD 2635
9629306   2493 VYQRPlADEAGPSAPTAARDPrdlaggdGGSGPEDPAAPPArqadPGVLAPTLLTDATTGEPVPPRMWAWIHGLEELASD 2572
56694759  2488 AYRRP-AEARFPFAARGAPDP---------GPDPDPDAPPT----PSRPAPAILPDEPVGEAVHPRMLTWIRGLEELASD 2553
83722605  2534 AYRRP-AEARFPFAAGGAPDP-----------DPDPDAPPA----PSRPTPAILPDEPVGEAVHPRMLTWIRGLEELASD 2597
155041490 2495 VYQRA-PDDQSPSVPNPTPGPvdlvgaeGSLG-------------PGSLAPTLFTDATPGEPVPPRMWAWIHGLEELASD 2560
30984464  2636 DAGDPPP-PLPPAARPAAPDRSVPPPRPAPRPSEPAVQSRARRPDAPPQSARPRTPRDDPGPPAapsTLPPSPPPPAPHP 2714
9629306   2573 DAGGPTPnPAPALLPPPATDQSVPTSQYAPRPIGPAATARETRPSVPPQQNTGRVPVAPRDDPR---PSPPTPSPPADAA 2649
56694759  2554 DAGDPPP-PLPPAAPPAAPDRSVPPPRPAPRPSEPAVRSRARRPDAPPQPASPRTPGDDSGSPPg--PAAPNALPPDTHP 2630
83722605  2598 DAGDPPP-PLPPAAPPAAPDRSVPPPRPAPRPSEPAVGSRAHRPDAPPQPARPRAPGDDSGSSPg--QAAPASLPPDTPR 2674
155041490 2561 DSGGPAP-LLAPDPLSPTADQSVPTSQCAPRPPGPAVTAREARPGVPAESTRP-APVGPRDDFRrlpSPQSSPAPPDATA 2638
30984464  2715 PDPPPPDPSPRPNElgggetaaapsapdppppqtvpaperprddraPAPGRVSLPRRASRQGRPA-PSSPLQRPRRRAAR 2793
9629306   2650 LPPPAFSGSAAAFS--------------------------------AAVPRVRRSRRTRAKSRAPrASAPPEGWRPPALP 2697
56694759  2631 PDPPPPAPRPHGNEapephplpta-------------pppeqprddPAPRRVSPRRRV----------SPPRRPRRRAAR 2687
83722605  2675 PDPPPPGPRPRATEpggggaaaapdpdpr---ppttvppperprnaPAPGRVSLPRRATRPGRPAgASSPPRRPTRRAAR 2751
155041490 2639 PRPPASSRASAAS---------------------------------SSGSRARRHRRARSLARATqASATTQGWRPPALP 2685
30984464  2794 PAVGSLTNLADPHPPGPetptptsptanphattasaTPAPPPvaatgptRPTSPATPTPTVAAAGRASAPPAPAAPAAPA 2873
9629306   2698 APVAPVAASARPPDQPP-------------------TPESAP-------PAWVSALPLPPGPASARGAFPAPTLAPIPPP 2751
56694759  2688 PTVGSLASLADPPPPER-------------------EPEPRP----------------------------------APRA 2714
83722605  2752 PAVGSLTSLADPPPPE---------------------PEPRPatpatpaTPATPATPATPAT-------PATPATPATPA 2803
155041490 2686 DTVAPVTDFARPPAPPK-------------------PPEPAP-------HALVSGVPLPLGPQAAGQASPALPIDPVPPP 2739
30984464  2874 APAAPAAPAAPAAPAAPAAPAAPaAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAAPAPAAVPVVVPAPTATLTattt 2953
9629306   2752 PAEGAVVPGGDRRRGRRQTTAGP-SPTPPRGPAAGPPRRLTRPAVASLSASLNSLPSPRDPADHAAAVSAAAAAVP---- 2826
56694759  2715 SPNAPATDVSVTPVPSPPATSGApRSAPPAAPPTTPPPAApv-------------------------------------- 2756
83722605  2804 TPATPATPATPATPATPATPATPpSAAAAADRASAPPATTTPPAGSSAAVATAAAPLPSDASPAPAAATPPASALNpa-- 2881
155041490 2740 VATGTVLPGGENR--RPPLTSGP-APTPPRVPVGGPQRRLTRPAVASLSESRESLPSPWDPADPTAPVLGRNPAEPts-- 2814
30984464  2954 tspapaatPASPVPTPTSSLPTPP---------SKPPAFFQPSLATGGSVAPGGDFRRRAPSRPTAAVPAAPSRPP---- 3020
9629306   2827 --------PSPGLAPPTSAVQTSPp--------PLAPGPVAPSEPLCGWVVPGGPVARRPPPQSPATKPAARTRIR---- 2886
56694759  2757 ------qaPAATLPPPTTPTPAAP-----------PKPPLESTLSMGGAVAPGGDFRRRGPSRAAPA-PATPRHPP---- 2814
83722605  2882 ------arPATLEPPTTTAAPAASaasaasaahATPSEPSPEPTPPGGSVAPGGDLRRRGPAGSAPPKVAAPPHPP---- 2951
155041490 2815 ------ssPAGPSPPPPAVQPVAP---------PPTSGPPPTYLTLEGGVAPGGPVSRRPTTRQPVATPTTSARPRghlt 2879
30984464  3021 ARRLARPAVSRSteSFALPPDELARPRTPEAPAPPTETEEAPVAERPAPPEPPQGRPPSPAAPdagpaaasgpsggvpap 3100
9629306   2887 ARSVPQPPLPQP--PLPQPPLPQPPLPQPPLPQPPLPQPPLPQPPLPQPPLPQPPLPQPPLPP----------------- 2947
56694759  2815 VRRLARPAVSRSteSFALPPDSPERPPPPDSPERPRTPATEEAPASETPAPRTPGRSDAPLAPttdtagageptgaapnp 2894
83722605  2952 VRRMARPAVSRSteSFALPPDGPERPRTPAAATEA--------------APETPARPDAPLAPttdtagvgeasgvvpdp 3017
155041490 2880 VSRLSAPQPQPQpqPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPqpqpqpqpqpqp----- 2954
30984464  3101 rlgalvpgrvaVPRRQIPPPAPPREIPAPSPPPPRSH-APRVSSWASSLALHEEPDAGPVSLKQTLWPPDELDDASDDSS 3179
9629306   2948 -----------VTRTLTPQSRDSVPTPESPTHTNTHLpVSAVTSWASSLALHVDSAPPPASLLQTLHISSDDEHSDADSL 3016
56694759  2895 wlgalvpgrveVPR-RVSSPAPSREAPAPSTSSLHDH-DPRLSSWASSLALDEETDPRPVSLKQTLWPPDDTEGSD---- 2968
83722605  3018 wlgalvpgrvaVPR-RVSSPAPSRETPASSTPSLRRHaTSRVSSWASSLALHEETDHGPVSLKQTLWSPDDTEESD-DSS 3095
155041490 2955 qnghvapgeypAVRFRAPQNRPSVPASASSTNPRTGSsLSGVSSWASSLALHIDATPPPVSLLQTLYVSDD-EDSDATSL 3033
30984464  3180 LDSDPErlDLGSLDPETDPETDPFAHPPdPRAPEAGDRASPSSYFGPPPLSANAALSRRYVRSTGRSALAVLIEACWRIR 3259
9629306   3017 RFSDSD--DTEALDPLPPEPHLPPADEP-PGPLAADHLQSPHSQFGPLPVQANAVLSRRYVRSTGRSALAVLIRACRRIQ 3093
56694759  2969 ---DTEdsDESSVDANPNDPNDP----NdPPTPEAGAREDPGSHFGPPPLSANAALSRRYVRSTGRSALAVLIEACRRLR 3041
83722605  3096 VDSDPGrfDLEAPDPDDPD---PFAHPPdPNTPEAGARASPSSHFGPPPLSANAALSRRYVRSTGRSALAVLIEACRRIR 3172
155041490 3034 FLSDS---EAEALDPLPGEPHSPITNEPfSALSADDSQEVTRLQFGPPPVSANAVLSRRYVQRTGRSALAVLIRACYRLQ 3110
30984464  3260 RQLRMTRHALLNRSGAVLTGLYHVRMLLG 3288
9629306   3094 QQLQRTRRALFQRSNAVLTSLHHVRMLLG 3122
56694759  3042 RQLRRTRHALIDRSEAVLTGLYHVRMLLG 3070
83722605  3173 RQLRRTRHALLDRSGAVLTGLYHVRMLLG 3201
155041490 3111 QQLQRTRRALLHHSDAVLTSLHHVRMLLG 3139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap