Conserved Protein Domain Family
PLN02466

?
PLN02466: PLN02466 
aldehyde dehydrogenase family 2 member
Statistics
?
PSSM-Id: 215259
View PSSM: PLN02466
Aligned: 14 rows
Threshold Bit Score: 1052.48
Threshold Setting Gi: 168067494
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115448461   1 MAARRaASSLLSRGLiarpsaass-tgdsailgaGSARGFLPGSLHRFSaapaAaaTAAATEEPIQPPVDVKYTKLLING 79 
115467518   4 AAARR-GSSLLSRCLlsrpaaaaspavpsalrraDGTQGLLPGILQRFS----T---AAVAEEPISPPVQVNYTQLLIDG 75 
15228319    1 MAARR-VSSLLSRSFsassp---------llfrsQGRNCYNGGILRRFG----T--SSAAAEEIINPSVQVSHTQLLING 64 
18395300    1 MASRR-VSSLLSRSFmsssr---------sifslRGMN----RGAQRYS----N--LAAAVENTITPPVKVEHTQLLIGG 60 
224064707   1 MAAKK-ISTVLSRSFssaaap-------pcffsrVRGGGGQSRLISRYN----T--TLAAVEDPITPPVSVKYNQLLING 66 
225424691   1 MTIPR-ISSLLSRSFtssass--------allssIGRNSSRRGGIFRYS----T---AAVVEEPINPSVNVNYTQLLING 64 
225452510   1 MAAPR-IFSLLSASStaas------------lrsFGRYSRWGRGSSRFS----T--AVATEEEPITPPVQIDYTQLLING 61 
225457075   1 MAARR-ISSLLSRSLsvssa----------fslsLGKNFNRGKSIHRFS----Ta-AAAAVEELITPTVQINYTQLLING 64 
255540719   1 MAAPR-ISSLISRSLsasl------------llsLGKNPNRGRSIYRFS----T---AAVAEEPITPPVQISYTQHFING 60 
297819414   1 MAARR-VSSLLSRSLsassp---------llfrsQGRNCYNGGILRRFG----T---SSAAEEIINPSVQVSHTQLLING 63 
115448461  80 NFVDAASGKTFATVDPRTGDVIARVAEGDAEDVNRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLIEQHADEIAALET 159
115467518  76 KFVDSASGKTFPTLDPRTGELIAHVAEGDAEDINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALET 155
15228319   65 NFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVKAARTAFDEGPWPKMSAYERSRVLLRFADLVEKHSEELASLET 144
18395300   61 RFVDAVSGKTFPTLDPRNGEVIAQVSEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHNDEIAALET 140
224064707  67 QFVDAASGKTFPTLDPRTGEVIAHVAEGDVEDVNRAVSAARKAFDEGPWPRMTAYERSRIIWRFADLLEKHTDEIAALET 146
225424691  65 QFVDAATGKTFETLDPRTGNVIASVAEGDAEDVNRAVSAARKAFDEGPWPRMSPYERSKILLRFADLLEKHNDEIAALET 144
225452510  62 RFVDAASGKTFPTLDPRTGDVIAHVAEGEAEDINRAVSAARKAFDEGPWPKMTPYERSCILFRFADLLEKHCSEIAALES 141
225457075  65 QFVDAASGKTFPTFDPRTGEVIANVAEGDAEDINRAVSAARKAFDEGPWPRMSPYERSRILLRFADLAEKHNDELAALET 144
255540719  61 QFVDAASGKTFPAYDPRTGQVIAQVAEGDAEDINRAVAAARKAFDEGPWPKMTAYERSRIILRFAELVEKNNDELAALET 140
297819414  64 NFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMSAYERSRVMLRFADLVEKHSEELASLET 143
115448461 160 WDGGKTLEQTTGTEVPMVARYMRYYGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGN 239
115467518 156 WDNGKPYAQAANIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGN 235
15228319  145 WDNGKPYQQSLTAEIPMFARLFRYYAGWADKIHGLTIPADGNYQVHTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGN 224
18395300  141 WDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGN 220
224064707 147 WDNGKPYEQSAKIEIPMTVRIFRYYAGWADKIHGLTVPADGPYHVQTLHEPIGVAGQIIPWNFPMLMFSWKVGPALACGN 226
225424691 145 WDNGKPFEQAAKAEVPLVIRLMRYYAGWADKIHGLTVPADGLHQVQTLHEPIGVAGQIIPWNFPLLMYAWKIGPALACGN 224
225452510 142 WDNGKPYEQAANVEIPMVIRVFRYYAGWADKIHGLTVPADGLHHVQTLHEPIGVAGQIIPWNFPLLLYGWKVGPALACGN 221
225457075 145 WNNGKPYEQAAKAELPLFVRLFRYYAGWADKIHGLTVQADGPHHVQILHEPIGVAGQIIPWNFPLMMFAWKVGPALACGN 224
255540719 141 WNNGKPYEQSAKSELPLLSRLFHYYAGWADKIHGLTVPADGNHHVQILHEPIGVAGQIIPWNFPLILFAWKVGPALACGN 220
297819414 144 WDNGKPYQQSKTVEIPMFARLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGN 223
115448461 240 AVVLKTAEQTPLSALFVASLLHEAGLPDGVLNVVSGFGPTAGAALSSHMGVDKLAFTGSTGTGKIVLELAARSNLKPVTL 319
115467518 236 TVVLKTAEQTPLSALFASKLLHEAGLPDGVVNVVSGFGPTAGAALASHMDVDKIAFTGSTDTGKVVLELAARSNLKSVTL 315
15228319  225 TIVLKTAEQTPLTAFYAGKLFLEAGLPPGVLNIVSGFGATAGAALASHMDVDKLAFTGSTDTGKVILGLAANSNLKPVTL 304
18395300  221 TVVLKTAEQTPLSALLVGKLLHEAGLPDGVVNIVSGFGATAGAAIASHMDVDKVAFTGSTDVGKIILELASKSNLKAVTL 300
224064707 227 TVVIKTAEQTPLSAVYAAKLFHEAGLPDGVLNVVSGFGPTAGAALASHMDVDKLAFTGSTDTGKIVLELASKSNLKPVTL 306
225424691 225 TIVLKTAEQTPLSALYASKLLHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTATGKIVLQLAARSNLKPVTL 304
225452510 222 TIVLKTAEQTPLSALYASKLLYEAGLPPGVLNVVSGFGPTAGAALSSHMDVDKLAFTGSTGTGKIVLGLAAKSNLKPVTL 301
225457075 225 TIVLKTAEQTPLTALFAAKLFHEAGLPPGILNIVSGYGPTAGAALASHMDVDKIAFTGSTDTGKIVQELASKSNLKPVTL 304
255540719 221 TIVLKTAEQTPLTALYAAKLFHEAGLPPGVLNVVSGYGPTAGAALASHMDVDKLAFTGSTETGKIVLELSAKSNLKPVTL 300
297819414 224 TIVLKTAEQTPLTAFYAGKLLLEAGLPPGVLNIVSGFGATAGAALASHMDVDKLAFTGSTDTGKVILGLAANSNLKPVTL 303
115448461 320 ELGGKSPFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRVVGDPFRTGVEQGPQIDG 399
115467518 316 ELGGKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRVVGDPFKNGVEQGPQIDD 395
15228319  305 ELGGKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSKARALKRVVGDPFRKGIEQGPQIDL 384
18395300  301 ELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRNVGDPFKSGIEQGPQVDS 380
224064707 307 ELGGKSPFIVCEDADVDQAVELSHSAVFFNQGQCCCAGSRTFVHERVYDEFVEKAKARANQRAVGDPFKEGIEQGPQVDS 386
225424691 305 ELGGKSPFIVCEDANVDEAVELAHFALFFNQGQCCCAGSRTFVHESIYDEFVEKAKARALRRTVGDPFKAGIEQGPQIDS 384
225452510 302 ELGGKSPFIVCEDADVDKAVELSHTALFYNQGQSCCSGSRTFVHESIYDEFIEKAKARALKRVVGDPFKKGVEQGPQIDS 381
225457075 305 ELGGKSPFIVCEDADIDQAVELAHFALFFNQGQCCCAGSRTFVHESVYDEFIEKAKARALSRTVGDPFKKGIEQGPQIDP 384
255540719 301 ELGGKSPFVVCEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFLEKAKARAMRRVVGDPFRKGVEQGPQIDS 380
297819414 304 ELGGKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSKARALKRVVGDPFRKGIEQGPQIDS 383
115448461 400 EQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVEDEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGL 479
115467518 396 EQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQDNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGL 475
15228319  385 KQFEKVMKYIKSGIESNATLECGGDQIGDKGYFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANETKYGL 464
18395300  381 EQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGL 460
224064707 387 DQFEKILRIIRSGVESGANLKAGGDRFGTTGYYIQPTVFSDVQDDMLIAKEEIFGPVQSIFKFKDLDEVIQRSNNSRYGL 466
225424691 385 DQFEKILRYIRSGVENGATLETGGERFGKEGFFIKPTVFSNVQDGMLIAQDEIFGPVQSILKFKDLGEVIRRANATSYGL 464
225452510 382 QQFNKILGYIKSGIEAGATLEAGGEKFSSKGYYIQPTVFSNVHDNMLIAKEEIFGPVQSILKFKDLDEVIRRANATHYGL 461
225457075 385 EQFAKVLRYIRSGIESNATLECGGGRIGSKGYFVQPTVFSNVQDDMLIAKDEIFGPVQSILKYKDLDEVIRRANSTRYGL 464
255540719 381 EQFQKVLRYIKSGIESNATLECGGDRFGPRGYFIQPTVFSNVQDDMLIAQDEIFGPVQSILKFKDLDEVIRRANTTRYGL 460
297819414 384 KQFEKVMKYIRSGVESNATLECGGDQIGDKGYFIQPTVFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANETRYGL 463
115448461 480 AAGVFTQRLDAANTLARALRVGTVWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDAAWL 553
115467518 476 AAGVFTNNLNTANTLTRALRVGTVWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL 549
15228319  465 AAGVFTKNLDTANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI 538
18395300  461 AAGVFTQNLDTAHRLMRALRVGTVWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL 534
224064707 467 AAGIFTHNLDTANTLSRALKVGTVWINCYDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTSLKNPAWL 540
225424691 465 AAGVFTQNLDTANTLTRALKVGTVWINCFDVFDAAIPFGGYKMSGHGREKGIYSLQNYLQVKAVITPLKNPAWL 538
225452510 462 AAGIFTQNLDTANTLTRALRVGTVWINCFFVFDAAIPFGGRKMSGHGREKGIYGLSNYMQVKAVVTPLKNPAWL 535
225457075 465 AAGVFTKNINTANTLTRALRVGTVWVNCFDVFDAAIPFGGYKMSGVGREKGIYSLNNYLQVKAVITPLKNPAWL 538
255540719 461 AAGVFTNNIDTANTLSRALRAGTVWVNCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL 534
297819414 464 AAGVFTKSLDTANRVSRALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLSNYLQIKAVVTALNKPAWI 537
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap