Conserved Protein Domain Family
PRK02224

?
PRK02224: PRK02224 
DNA double-strand break repair Rad50 ATPase
Statistics
?
PSSM-Id: 179385
View PSSM: PRK02224
Aligned: 15 rows
Threshold Bit Score: 934.457
Threshold Setting Gi: 222478619
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
73667909     1 MKLKNLHIENIRSYKKLDFTFEDGVTVISGVNGSGKSSLLEACFMGLFGSKILSkDfVLADVIFKGAENAKINLGFEHLG 80  
21228296     1 MKLKNLYIENIRSYKKLDFTFEDGVTVISGVNGSGKSSLLEACFMGLFGSKILSkDfVLADMIFKGAESAKIHLGFEHLG 80  
15789741     1 MRFTRLSLSNFKCYADAAVSLDPGVTVIHGLNGSGKSSLLDACFFALYGTTALD-T-TLADAVTIGAETAEIDLHFEHAG 78  
169235456    1 MRFTRLSLSNFKCYADAAVSLDPGVTVIHGLNGSGKSSLLDACFFALYGTTALD-T-TLADAVTIGAETAEIDLHFEHAG 78  
292655017    1 MRFTRIAIRNFKPYEDAELDLRDGVTVIHGVNGSGKSSLLEACFFALYGSKALA-G-TLEDVVTTGADDAEITLEFVHDG 78  
222478619    1 MNFDRVRLSNFKPYGDADLRLTEGVTVIHGLNGSGKSSLLEACFFALYGSKALD-G-TLGDVITNGEEETEVDLWFTHDG 78  
289582094    1 MRVDRVRMLNFKCYGDADLTLERGVTVVHGVNGSGKSTLLEAVFFALYGSKALD-DrTLDDVITTGENESEVELWFTHDN 79  
76801408     1 MRFERIRLRNFKCYAETELSLREGVTVIHGVNGSGKSSLLEACFFALYGSAAID-G-TLDDAIANDADEMSIELWFTHGG 78  
284164775    1 MRVDRVRLLNFKCYGEADLGLERGVTVVHGVNGSGKSTLLEAVFFALYGSKALD-DrTLDDVIMTGEEEAEVELWFTHDG 79  
110667658    1 MRFDHITLEHFKPYADASLDLQDGVTIIHGLNGSGKSSLLEACFFALYGARALD-E-TLDDIVTTDEDDATIELTFSHAG 78  
73667909    81 QDYLIEQAFRysSKSENASNSKCVLyANGES---IVDQATRTYEEVCSLLNMDEEAYRNCAYIRQGEIDVLINAKPKDRQ 157 
21228296    81 REYLIEQAFRysLKSENASNSRCVLfADGEN---IVDQATRTYEEVCALLNMDEEAYRNCAYIRQGEIDVLINAKPRDRQ 157 
15789741    79 GDYHVHRRIR--ASGGRAQTAACVL-ETPTD---RIDGVTDVEAHISGLLRMDAEAFVNCAYVRQGEVNKLINAAPSTRQ 152 
169235456   79 GDYHVHRRIR--ASGGRAQTAACVL-ETPTD---RIDGVTDVEAHISGLLRMDAEAFVNCAYVRQGEVNKLINAAPSTRQ 152 
292655017   79 GEYRIDRRVR--VSGDRATTAKCVL-DGPEG---TVEGARDVRRHVASLLRMDAEAFVNCAYVQQGEVNKLINATPSQRQ 152 
222478619   79 ASYHIERRLK---EYDGRIDHQCTL-ETTDGsdvTRDGARAVREFVTELLRMDAEAFVNCAYVRQGEVNKLINATPRERQ 154 
289582094   80 REYHIERHLK--LRGDRATTTKCVL-ETPED---TIEGARDVRKTVTELLRMDAEAFVNCAYVRQGEVNKLIHASPSERQ 153 
76801408    79 GEYRIERNIK--RRGGSAQTTTCLL-ETPNG---TVEQVTDVEAHIEELLRMDADAFVNCAYVRQGEVNKLINATPSERQ 152 
284164775   80 REYHVERRLK--LRGDRATTTKCVL-ETPTE---TFEGARDVRREVTELLRMDAEAFVNCAYVRQGEVNKLIHASPSDRQ 153 
110667658   79 SQYHIKRRLR--RSGDRIQTAQCTL-DGPDI---EIDGATDVRAFITDILRMDAEAFVNCAYVRQGEVNKLINATPTQRQ 152 
73667909   158 RMIDGLLQLGKLEEYRERAGSAKTAVRRLQRDTSNSLSGVKAEIEGIESTEPHAVLNGLRQKIKESDTILKKCNENKEAA 237 
21228296   158 RMIDDLLQLGKLEEYRERAGYAKTAVRRLERDAKNSFLGVKAEIEGIESTEPVAAVNRLRQKVKETDAILEELNKKKEFA 237 
15789741   153 DMIDALLQLGKLEEYRQRAGDARLGVEDVKSNVEGQLDRLADQIADKEAADPHDRLASHNTALAEVTADIEHFEAEREQA 232 
169235456  153 DMIDALLQLGKLEEYRQRAGDARLGVEDVKSNVEGQLDRLADQIADKEAADPHDRLASHNTALAEVTADIEHFEAEREQA 232 
292655017  153 DMIDDLLQLGKLETYRERAGNARLGVEDVLTKKRSVLEDVESQIEAKEDADLHATLNALESELDSLDEEISNYESQRDKA 232 
222478619  155 DTIDDLLQLGKLEEYRERAGDARLGVEDVLENRRGRLDQLDDQIAEKKEKDLHDRLNGLESDLSEVTDEIDRYETQREQA 234 
289582094  154 DMIDDLLQLGALEEYRERASDARLGVKSVLDGQREVLDDVRSQVEQKEEQDLHETLNTLEKERDELTEQIDHYEAQRDQA 233 
76801408   153 DMIDSLLQLGTLEEYRERASDARVGVERVLSQQETLLEDKRATIAEKEQKSLHDRLNALRTELSELKSDIETKEEERETA 232 
284164775  154 DMIDDLLQLGALEEYRERASDARLGVKTVLDGQREVLEDLHKQVEQKEEKDLHERLNGLESRRADVREKIDRFEEQREQA 233 
110667658  153 AIIDDLLQLGRLEMYRERASDARLGVEDILSEQRGAQTEIKAQIERKEDANLHEKLNEYEAARADIDAEIERYEENKIRA 232 
73667909   238 AAQKEKLDLMITEHRERLQEIQTLKQALSKSQEDKAGCIREKEAFAREAHEQRQALLGLEEENNHIRGECGFG------D 311 
21228296   238 AARKGELDLRIAEYRERLQEIEVLKQAIRKSQEDKAACFKEKETFSEEVQVQRRVLLELGEENSGMREECGFG------D 311 
15789741   233 RQTRDDAADVLERYEESRTALADVEETIADVREAVAEAERERETLADRVSDHRERASDLDDEAAALAADLGLD------D 306 
169235456  233 RQTRDDAADVLERYEESRTALADVEETIADVREAVAEAERERETLADRVSDHRERASDLDDEAAALAADLGLD------D 306 
292655017  233 KSALDAAEATLDEHAEKRERLDEIESAIEDLTAKISADETKRDDLSERVRELDAAADELESDIDDALARADLD------D 306 
222478619  235 KETREAAAETLSTHAEKRETLESVAAEIDEIEATIREAERERDEHRDAVREARERVEEIEAAIDGRLDGAGLD------A 308 
289582094  234 VETLETAQEVLERHEETREEIETLGEEIDDLQSKITETERDREDAKDEIRERKEAREELADERNELLADLEREvdpgadS 313 
76801408   233 VETKQEAVEVLEAYEQRREEIETLEADIEELTEDIAAAESERDALGERLRSLRETTETLRERRDDALAETELE------R 306 
284164775  234 RQTLETAEDVLERHEETREEIDRLDEEIEELRSKITETERKRENAKDEIRDLESRRETLADEREELLAEVDLEdt---dG 310 
110667658  233 QETRDNAKEILTSHEETQEELTELEAEIDDLRMTIEEDESTRADFREAIETKTEQVETLLSARTDALSSAEVT------S 306 
73667909   312 LEIEALSLQKEkeeflarekvnviskelalllreeevhtqdlrDFENEKAETEQSLMQCRADIGATNGEIEGNRKNILRI 391 
21228296   312 LEIEALLLQQEksessarekvnsgskelalllkeeetgvqalrELEKDKVETERVLVECRTSIGAANKEIEGYRANIKQL 391 
15789741   307 PDAEDASAERD--------------------------------AVADQREAVAERVREVAPAVSRLTEQADSAADDAATL 354 
169235456  307 PDAEDASAERD--------------------------------AVADQREAVAERVREVAPAVSRLTEQADSAADDAATL 354 
292655017  307 ASDEAIADARE--------------------------------ALSARESELRDDLSEARTRAQAFETQAERLRERADDL 354 
222478619  309 ASDETIAERRA--------------------------------ELDGREETVREELDDERVSAEAFRNQATNLTGKADDR 356 
289582094  314 GAETSVEQHID--------------------------------DLEERDEELQDDLADVRVSIQTKTETADRLREEADDL 361 
76801408   307 ADAERVEERLE--------------------------------ELSEAIEGVRETIEEKRLAAQEHLNDAESATDDAEAH 354 
284164775  311 ASDKAVEDRIE--------------------------------DLEARDEELRDELEEVRVAITETNGEIERLREEADDL 358 
110667658  307 ADADTLAARRS--------------------------------TLDDKESSIRDSLQTARQQQTMFENQAERLTERVDEL 354 
73667909   392 EDENKKLKEAAKettgftdtyeiplfineleekesllrerkneastklalafkeketgdinllTLDKELQNTKVAVRKSK 471 
21228296   392 EEENKRLREKAGfgaageiasvikeleekesllrdr----knevstklgfalkekesgdaslrELDSEMQSCRVAVSKGK 467 
15789741   355 DERAETLREEAA---------------------------------------------------ALDAEADDAAAKRDDAA 383 
169235456  355 DERAETLREEAA---------------------------------------------------ALDAEADDAAAKRDDAA 383 
292655017  355 ESRAEEKREAAE---------------------------------------------------VDAETAAEAERELESFR 383 
222478619  357 AERAAEIESEAD---------------------------------------------------DLGDEAEAAADEADERE 385 
289582094  362 ETRADEARTDAD---------------------------------------------------EIESELETTESEIGDRE 390 
76801408   355 RERATEARNEAA---------------------------------------------------TLESDIESARETLETRE 383 
284164775  359 EGQAADAREEAA---------------------------------------------------DLESKLEADEEAIADRE 387 
110667658  355 ESRADELQEQAS---------------------------------------------------EAETAVTKAKEQITTQQ 383 
73667909   472 TEIEILEEELRENEKAVlevkeqkse---------asaglkglGFTGEQLEDLEYLSELLLENKNRLHGREKELEATLRE 542 
21228296   468 SEIEALEKEIRDNSKAVldfqeqkse---------vfaglkalGFTEEQLENLEDFNELLLENKNRLHGKEKELEVTLRE 538 
15789741   384 ARIEALDADIEAAMAAF--------------------------DDAPVAFGAAEAFLDDATAERDELRERVATLRADRQS 437 
169235456  384 ARIEALDADIEAAMAAF--------------------------DDAPVAFGAAEAFLDDATAERDELRERVATLRADRQS 437 
292655017  384 ETRAELRSALDDAEARF--------------------------EDAPVELGEAADLLEERREARSEARESLAETETELKN 437 
222478619  386 SSVEELREEAETLRERFa------------------------aADADIDRDGVADEREALRERRGEVRERIAELSAELKN 441 
289582094  391 EKLSELEDEIDELRGRFvggdkdededkdededkdedededttDNLTVAFGEAETRLAELESDREDAVAERNDLTADLRT 470 
76801408   384 SDLDELDEEIETLREELegeva----------------esddgGDIETRRERLSERRDELRETLAATNERLAERRADLQN 447 
284164775  388 GKLEELDEQIEAARERF--------------------------ADAPVDFGDAADHLESLESERDELTGEIGDVTADIRT 441 
110667658  384 NAQADIEEQMTSVREQF--------------------------NNSPATLGKATEYLEMLQEEHDDIRNDLASTRASLST 437 
73667909   543 LDKVIRKNRQLLAEGKCPTCGQDLKGSEIACTTGESEQKREKLAAELLDIKLQQAEVEKKLNRLKDAKKLEKRIsdydle 622 
21228296   539 IENTLRKNRELLAEGKCPTCGQELKGSGIACTAEECEEKKEKLSLELADIKLQRAELEKKLNRLKEAKKLEKQAydydie 618 
15789741   438 AADRVAEAEALLDEGKCPECGQPVEGAPHVERVTDDRERVAELDAELADVEDELDAVAQRVDRGESLVAAEDRV------ 511 
169235456  438 AADRVAEAEALLDEGKCPECGQPVEGAPHVERVTDDRERVAELDAELADVEDELDAVAQRVDRGESLVAAEDRV------ 511 
292655017  438 ARERLAEAERLRDAGKCPECGQPVEGSPHVDAISEREAAVESLEADRESLESAVESRSAAVEAAEALVEVETRA------ 511 
222478619  442 ARDRVEEAEELLAAGKCPECGQPVEDSPHASGIDEDREQVAELEAELEEARERESDLDDRLAELSELASAADRL------ 515 
289582094  471 VENAIEEGEALLEEGKCPECGQSVEDSPHVDVLAEKREEAEELEAERETLAAEIEALDERIEQVEDLQEAERRV------ 544 
76801408   448 ARERVEEAAALLEAGNCPECGQPIEDESDVEGLEDAREQVGTLETEVEQLEAEVERLEADHERAVKAAETAAEL------ 521 
284164775  442 VENAIEEGERLLEEGKCPECGQPVEDSPHVDVLEEKREERDELEERRDKLEDERDDVDERIERAEDLREAERRV------ 515 
110667658  438 VQDRRNEAQTLQEAGKCPTCEQPIEESPHVEAIDEYDVQIETLTERLSQLETKQNKVNNKIESAESLVESERQF------ 511 
73667909   623 tERLKNKAKDLQERITIHKTRTEEDSLKLEGLNKQKEELEAKMgkllpdikalQGWEAAAQKAHGESERVLQEAKAFEKK 702 
21228296   619 iEKLLEKAKASEKLIDTHRTRIEEDSLKLESSGKRKQELEAAGskllldikalREQEKAAQKVHLESEKALREAKVFERK 698 
15789741   512 -DDLEQQRERAVERRDEQADIADAKRDQAAEKRDRAADLDAEA----------EDARADAAAKRDAADEKRETLAALNAD 580 
169235456  512 -DDLEQQRERAVERRDEQADIADAKRDQAAEKRDRAADLDAEA----------EDARADAAAKRDAADEKRETLAALNAD 580 
292655017  512 -SSRRDRLDLVDERIADREETVESRREAAEEKREAAAELDSEA----------EEKREAATTQAERAEEVAETVDSLESD 580 
222478619  516 -DEIDETVETLEDRVEEKHAEADRKREAAAEKRERVEDLREEA----------EETHDVATEKREEAEAAAERVAELEDA 584 
289582094  545 -ERLADNRDNVEQLLAQKRETIADRREQCTELREEADELESDA----------EAKREEASELESEVDEVRVELGKINGE 613 
76801408   522 -QSSLERRQDVESLLDQQRETIAEKETRAESLREQAADHETEA----------EAAEERAQAAEERAQAAREAIGELNGR 590 
284164775  516 -DRLAENRENIEQLLAEKRETLEERREQRDRLREEASEYEDEA----------AEKRAQADDLEEEIADHRGELGAINTE 584 
110667658  512 -ETLKERKSLASERIADARETVNEQTETAASLHENAGELETEA----------DEKRDAAATQMSNADSEAEKVATLESK 580 
73667909   703 LAENTSEIESLNgKIRTSLALIENYGQRLGELNEKLKGLAERETQEKEKLKtlevelealrkkealakethdesskhllk 782 
21228296   699 LAENASEIESLNgKIRTSLALIENYGQRLGELNEKLKAFAEKETQSKEKLEaleltletarkneeeakkahiesarllge 778 
15789741   581 QTALKERLDALA-DLVDRLEAAADAREAAQRLAEKRAALAAQNEQRRDRLS----------------------------- 630 
169235456  581 QTALKERLDALA-DLVDRLEAAADAREAAQRLAEKRAALAAQNEQRRDRLS----------------------------- 630 
292655017  581 LDTLDDRRDRLD-RVESLVDTRAEKIDARDRLREKRETLAEVNRERREHLR----------------------------- 630 
222478619  585 LAAVDDAREAVA-AIEEQLSAIADAEDEIERRREKRENLNEVNDERRDRLA----------------------------- 634 
289582094  614 RSAIKETLQALR-RLREIADERAELERQIVTRRERRADWQEMNEERRETLS----------------------------- 663 
76801408   591 KADLDERRERLE-TVASLLADIAENESDIESLRERREHLTELNDQRRERLD----------------------------- 640 
284164775  585 RGEIKESLESLR-RIAEIDDERTELAAEVENRRERRDDWQTMNDERRETLS----------------------------- 634 
110667658  581 LETINNARDQLD-NLAEIQSEIENIRAEIERLRERREEIADRNDERREYLQ----------------------------- 630 
73667909   783 tkklganliqmdnikhkiseleasirnlaekvgffdreilERNERVKQLEGKLQGSRFEDLQSKRTQLEEYQANLTEK-T 861 
21228296   779 akklqanllrmqnikhkisefeagignlaekigffdreivERSDRIRQLEGKLEGNRLEELQQKLARFEEAQVNITEK-I 857 
15789741   631 ----------------------------------------ELRERKRTLDSEFDADRIETARADKDRAEDYLEQVEPK-L 669 
169235456  631 ----------------------------------------ELRERKRTLDSEFDADRIETARADKDRAEDYLEQVEPK-L 669 
292655017  631 ----------------------------------------ERRERRDELRETVDEEAVEGAKQRKKNAAAYLERVEDEvL 670 
222478619  635 ----------------------------------------DKRERRDELAEAVDEAAVDEARERKETAEEYLEKVDGE-L 673 
289582094  664 ----------------------------------------AKRDRKRELEDEFDDARVEAAREDRQNADTYIEQVEEK-L 702 
76801408   641 ----------------------------------------EKRTRKAELEAEFDDAAVTEAKAQKQRAEEYIDEVASY-L 679 
284164775  635 ----------------------------------------SKRERKRDLESEFDEERIETARGDKENAEQYIAKVDDK-L 673 
110667658  631 ----------------------------------------AKRDRHAELAADVNEARIEKAQNNHEEAVSYLEDVSEK-L 669 
73667909   862 RQTTAAKDALLKEVGMVENSLKRRNELKDELKALENRKQYLEAVYSNAEELESMYMRVRADMRNRNIGALSTLLNEMFSF 941 
21228296   858 REITAEKDTLLKEIGMIENSLKRLKELKEELKALENKRLYLEAVYNNADELENTYMRVRADMRARNIGALSILLNEMFSF 937 
15789741   670 QALREDRDDLQAKIGAAENAIAELESLREEHERVQSRHQDLQAVHDEVTALETMYGELRAELRQQNVSKLERLLNETFEL 749 
169235456  670 QALREDRDDLQAKIGAAENAIAELESLREEHERVQSRHQDLQAVHDEVTALETMYGELRAELRQQNVSKLERLLNETFEL 749 
292655017  671 PELREKRDDLQSRVGGVEAELEQLDDLRERRDHLAERVDALESVHDEVSTLESTYGDLRAELRQRNVEVLERMLNETFDL 750 
222478619  674 DRLAERRTELENAIGGVNSEIQELENLREERESLAERVDALEDLHEETSELEAMYGDLRAELRQRNVAELERTLNETFEL 753 
289582094  703 DDLEEQRDDVQGTIGGVEEKLDELERLRDRLVAVEETCETLESLYDEAETLQTTYGELRSDLRQQNVETLERLLNETFDL 782 
76801408   680 ETKREERDKLQSDIGAVKNELEELEALRERRDELEATVERLRTLRDEARTLQDTYADLRSELRQQNVERLEAMLNEIFEL 759 
284164775  674 EELEEKRTEIQNAIGAAERELEELEELRDRLDTVENRCDRLESLYDEAETLQATYADLRAELRQRNVETLERLLNETFDL 753 
110667658  670 DELRDKRDNIQSQIGSVRGEIENLAELREKHTAINDRVSALETLHEQVETLSSTYRELRADLRKQNVETLERMLNEVFML 749 
73667909   942 MYTNNAYSHIELDPEYNLTVYRKDGTPLEPKLLSGGERAIFNLVLRCAIYRLLALGFGGDRAdgLPPMILDEPTVFLDRG 1021
21228296   938 MYTNNAYSHIELDPEYNLTVYRKDGTPLEPKLLSGGERAIFNLVLRCAIYRLLALGFGGDRPdgLPPMILDEPTVFLDRG 1017
15789741   750 VYQNDSYARIELSGEYELTVYQKDGEPLEPAQLSGGERALFNLSLRTAVYRLLAEGIEGDAP--LPPLILDEPTVFLDSG 827 
169235456  750 VYQNDSYARIELSGEYELTVYQKDGEPLEPAQLSGGERALFNLSLRTAVYRLLAEGIEGDAP--LPPLILDEPTVFLDSG 827 
292655017  751 VYANDAYSRIRLDGEYGLTVFQKDGTALEPEQLSGGERALFNLSLRCAIYRLLAEGIDGAAP--LPPLILDEPTVFLDGG 828 
222478619  754 VYGNDAYSHIELDGEYVLTVYQKDGEPLDPEQLSGGERALFNLSLRCAIYRLLSEGIEGAAP--TPPLILDEPTVFLDSG 831 
289582094  783 VYQNDSYAAIDLDGDYQLTVYQKDGESLDPEQLSGGERALFNLSLRCAIYRLLAEGVEGAAP--MPPLILDEPTVFLDSG 860 
76801408   760 VYQNDSYARIELDGDYELTVYQKDGTPLDPDQLSGGERAIFNLSLRCAIYRLLSEGIDGESP--TPPLILDEPTVFLDAG 837 
284164775  754 VYQNDSYAGIDLDGEYRLTVYQKDGEALEPEQLSGGERALFNLSLRCAIYRLLAEGVEGSAP--MPPLILDEPTVFLDSG 831 
110667658  750 IYDNDAYSRIQLDDAYELTIFQKDETALNPEQLSGGERALFNLSLRCAIYRLLAEGIDGTAP--MPPLILDEPTVFLDSG 827 
73667909  1022 HINQLLKLIDMMRGIGVGQIIVVSHDESLIDSADHVFQVEKDPITNMSSIVKL 1074
21228296  1018 HVRQLLKLIDMMRSIGVGQIIVVSHDESLIDSADHVFQVEKDPLTNMSSITKI 1070
15789741   828 HVSQLVELVESMRRLGVEQIVVVSHDDELVAAADDVVRVAKDATSNRSRVSTP 880 
169235456  828 HVSQLVELVESMRRLGVEQIVVVSHDDELVAAADDVVRVAKDATSNRSRVSTP 880 
292655017  829 HVSRLVDLVEDMQSRGVKQILIVSHDEDLVGAADDLVRVEKNPTTNRSTVERT 881 
222478619  832 HVSRLVRLVEEMRGFGVRQILIVSHDDELVGAADELVTVEKDPRTNRSTVRRE 884 
289582094  861 HVTQLVSLVESMRDLGVEQIVVVSHDQELVGAADSLVRVEKDATSNRSRLERG 913 
76801408   838 HVSKLVELVESMTDHGVEQIIVVSHDDELAGAADDLVAVRKNPTTNRSSVERS 890 
284164775  832 HVTQLVSLVESMRDLGVEQIVVVSHDEELVGAADSLVRVEKDATSNRSRLERG 884 
110667658  828 HVGRLVDLIKDMQRRGVAQILIVSHDKELIAAADHLVTVKKDPTSNRSSITRI 880 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap