Conserved Protein Domain Family
PRK08787

?
PRK08787: PRK08787 
peptide chain release factor 2; Provisional
Statistics
?
PSSM-Id: 136970
View PSSM: PRK08787
Aligned: 13 rows
Threshold Bit Score: 626.3
Threshold Setting Gi: 28198320
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21231300    1 MLEKTVIGIADVLAGLTDAGELLDLAESEQDEDTAVAVIADLDKYQAHVEKLEFQRMFSGQMDGANAFVDIQAGAGGTEA 80 
66768648    1 MLEKTVIGIADVLAGLTDAGELLDLAESEQDEDTAVAVIADLDKYQAHVEKLEFQRMFSGQMDGANAFVDIQAGAGGTEA 80 
188991534   1 MLEKTVIGIADVLAGLTDAGELLDLAESEQDEDTAVAVIADLDKYQAHVEKLEFQRMFSGQMDGANAFVDIQAGAGGTEA 80 
58582496   17 MLEKTVIGIADVLSGLVDAGDLLELAESEQDEDTALAVIADLDKYQTHVEKLEFERMFSGQMDGANAFVDIQAGAGGTEA 96 
84624384   17 MLEKTVIGIADVLSGLVDAGDLLELAESEQDEDTALAVIADLDKYQTHVEKLEFERMFSGQMDGANAFVDIQAGAGGTEA 96 
188575993  17 MLEKTVIGIADVLSGLVDAGDLLELAESEQDEDTALAVIADLDKYQTHVEKLEFERMFSGQMDGANAFVDIQAGAGGTEA 96 
21242619   17 MLEKTVIGIADVLSGLADAGDLLELAESEQDEDTAVAVIADLDNYQAHVEKLEFQRMFSGQMDGANAFVDIQAGAGGTEA 96 
78047471   62 MLEKTVIGIADVLSGLADAGDLLELAESEQDEDTALAVIADLDNYQAHVEKLEFQRMFSGQMDSANAFVDIQAGAGGTEA 141
15837713   26 LLDKTVTGIAHVLNGVAEASEFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQRMFSGKMDGANAFVDIQAGAGGTEA 105
28198320    1 -----------MLNGVAEASEFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQRMFSGKMDGANAFVDIQAGAGGTEA 69 
170729664  26 LLDKTVTGIAHVLNGVAEASEFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQRMFSGKMDGANAFVDIQAGAGGTEA 105
182680959   1 -----------MLNGVAEASEFLDLAEIEQDQEMLQAVLNDVDIYQLQVEKLEFQRMFSGKMDGANAFVDIQAGAGGTEA 69 
194365600  62 SLEKTVGGIASVLDGLADATELLELAESEQDEDTALAVVADLDKHQAHVEKLEFQRMFSGEMDNAAAFVDIQAGAGGTEA 141
21231300   81 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATIRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 160
66768648   81 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATIRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 160
188991534  81 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATIRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 160
58582496   97 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 176
84624384   97 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 176
188575993  97 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 176
21242619   97 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 176
78047471  142 QDWAEILLRMYLRWAESRGWKTELMEVSGGEVAGIKSATVRIEGEYAYGWLKTEIGVHRLVRKSPFDSDNRRHTSFTSVF 221
15837713  106 QDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGIKSATFRVEGDFAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 185
28198320   70 QDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGIKSATFRVEGDFAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 149
170729664 106 QDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGIKSATFRVEGDFAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 185
182680959  70 QDWAEMLLRMYLRWAEGRGWKAELLEVSGGEVAGIKSATFRVEGDFAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 149
194365600 142 QDWAEILLRMYLRWCESRGWKTELMEVSGGDVAGIKSATLRVEGDYAYGWLKTETGVHRLVRKSPFDSDNRRHTSFTSVF 221
21231300  161 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 240
66768648  161 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 240
188991534 161 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 240
58582496  177 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 256
84624384  177 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 256
188575993 177 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 256
21242619  177 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 256
78047471  222 VSPEVDDNIEIDINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNTVVACQTGRSQHQNRDNAMKMLAAKLYELEVQ 301
15837713  186 VSPEVDDNIDIEINPADLKTDVYRSSGAGGQHVNKTESAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAKLYESEIQ 265
28198320  150 VSPEVDDNIDIEINPADLKTDVYRSSGAGGQHVNKTESAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAKLYESEIQ 229
170729664 186 VSPEVDDNIDIEINPADLKTDVYRSSGAGGQHVNKTESAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAKLYESEIQ 265
182680959 150 VSPEVDDNIDIEINPADLKTDVYRSSGAGGQHVNKTESAVRITHVPSGIVVACQTERSQHANRDRAMKMLAAKLYESEIQ 229
194365600 222 VSPEIDDNIDITINPADLRTDVYRSSGAGGQHVNKTESAVRITHIPTNIVVACQTGRSQHQNRDNAMKMLAAKLYELEIQ 301
21231300  241 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 313
66768648  241 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 313
188991534 241 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 313
58582496  257 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 329
84624384  257 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 329
188575993 257 KRNVERDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 329
21242619  257 KRNAEKDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 329
78047471  302 KRNAEKDALEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAAGSKRLDA 374
15837713  266 KRNAEKDVLEASKSDIGWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDLDEFIEASLRAGLEAGAKRADA 338
28198320  230 KRNAEKDVLEASKSDIGWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDLDEFIEASLKAGLEAGAKRADA 302
170729664 266 KRNAEKDVLEASKSDIGWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDLDEFIEASLKAGLEAGAKRADA 338
182680959 230 KRNAEKDVLEASKSDIGWGSQIRNYVLDQSRIKDLRTGVERSDTQKVLDGDLDEFIEASLKAGLEAGAKRADA 302
194365600 302 KRNAEKDAVEATKSDIGWGSQIRNYVLDQSRIKDLRTGIERSDTQKVLDGDLDEFVEASLKAGLAVGSKRVDA 374
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap