Conserved Protein Domain Family
PRK09456

?
PRK09456: PRK09456 
?-D-glucose-1-phosphatase; Provisional
Statistics
?
PSSM-Id: 181872
Aligned: 96 rows
Threshold Bit Score: 381.694
Threshold Setting Gi: 251791708
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16762408    1 MLYIFDLGNVIVDIDFNRVLGVWSDLSRVPLASLKQKFTMGETFHQHERGEITDEAFAEAFCHEMALSLSYEQFAHGWQA 80 
251791708   1 MLYIFDLGNVVIDIDFNRVLGVWSNLSGAPLAALRKRFELGHTVALHERGEISDEEFASRLCHELGISLSFEQFSTGWQA 80 
290473308  15 MLYIFDMGNVIIDIDFKRVLAVWSNLSGTPLATLTTRFSMGEAFEQHECGQITDTAFAEALCDEMEVSLSFEQFTEGWHA 94 
197286704   1 MLYIFDMGNVIIDIDFNRVFAVWSKLSGVPLASIKDNFTTGETFKLHERGNITDIEFAEAVCAELGIGLSFEQFAEGWQA 80 
242241351   1 MLYIFDLGNVVIDIDFNRVLGVWSTLSGAPLATLRERFVMGPTFQQHERGEISDETFASQLCHEMGITLSYEQFAMGWQA 80 
37524260    1 MLYIFDMGNVIIEIDFKRVLAVWSNLSGTPLATLTKSFSMGETFEKHERGQITDLEFADTLCQEMNISLSFEQFAAGWHA 80 
261823694   1 MLYIFDLGNVVIDIDFKRVLGVWSNLSSAPLATLQERFVMGEAFEQHERGEISDEEFATRLCQEMGIALSFEQFSAGWQA 80 
253987666   3 MLYILDMGNVIIDIDFKRVLAVWSNLSGTPLATLTKSFSMGEMFEKHERGQITDLEFADTLCQEMSISLSFEQFTAGWQA 82 
50118994    1 MLYIFDLGNVVIDIDFKRVLGVWSNLSSAPLATLQERFVMGEAFEQHERGEISDEEFATRLCQEMGIALSFEQFTAGWQA 80 
271502628   1 MLYIFDLGNVVIDIDFNRVLGVWSNLSGAPLATLRKRFELGYTVELHERGEISDEEFASRLCHELGISLSFEQFSTGWQA 80 
16762408   81 VFVGLRPEVIAIMHKLREQGHRVVVLSNTNRLHTHFWPEEYPEVRAAADHIYLSQDLGMRKPEARIYQHVLQKEGFSAAD 160
251791708  81 IFIGVRKDVIEIMHRLRQEGHRVVILSNTNRLHCQFWPDEYPEVQQAADRLYLSQDIGLRKPEAAIYHHVLREEGVDASD 160
290473308  95 LFIDVRQDVIELMNKLREQGHRVVVLSNTNRLHFDYWPHHYPEIAASTDFLYLSQDLGMRKPNSDIFKYVLGAEGVTAVQ 174
197286704  81 IFIAVRPEVIDIMNKLREQGHRVVVLSNTNRLHQDYWPQHYPEIAASADFLYLSQDIGMRKPDPEVYKYVLQSEGVEAQD 160
242241351  81 IFIGLRREVVDIMHRLRHDGHRVVILSNTNRLHCEFWPTEYPEVVAAADRMYLSQDLGLRKPEADIYRHVLREEGVGASE 160
37524260   81 IFINIRPEVIQIMKTLREAGHRVVVLSNTNRLHLDYWPHNYPEIAASADYLYLSQDLAMRKPEPDIFKYVLETEGYSPDQ 160
261823694  81 IFVALRPEVIDIMQRLHQEGHRVVILSNTNRLHCSHWPALFPEVGTAADRLYLSQDIGLRKPELAIYQYVLTQEGVTPAQ 160
253987666  83 IFIDIRPEVIQIMEKLREAGHRVVVLSNTNRLHQDYWPHNYPEIAASADYLYLSQDLAMRKPEPDIFKYVLEKEGFSPDQ 162
50118994   81 IFVALRPEVIDIMQRLRQEGHRVVILSNTNRLHCSHWPALFPEVATAADRLYLSQDIGLRKPELAIYQYVLTQEGVTPAQ 160
271502628  81 IFIGVRKDVIDIMHRLRQEGHRVVILSNTNRLHCQFWPGEYPEVQQAADRLYLSQDIGMRKPEAAIYHHVLCEEGFAAGD 160
16762408  161 AVFFDDNADNIEGANQLGITSILVKDKATIPDYFAKLLC 199
251791708 161 AVFFDDNAANVDAANALGIRSILVSDRQVVPDFFASQVF 199
290473308 175 AVFFDDVLVNVEAARKIGINAIHVTDRSVIPDYFKAHDF 213
197286704 161 AVFFDDLQTNVDAAIALGIQGVHVVDKNTVVEYFKDHDF 199
242241351 161 VLFFDDNEANVVAAQALGIQAVQVHDRQVVPDFFARQE- 198
37524260  161 AVFFDDVLENVEAAKALGINSVHVVDRQTVPDYFEAIGF 199
261823694 161 AVFFDDNAANVDAAQSLGIHSILVTDRHVVPDFFAMQAT 199
253987666 163 AVFFDDVLENVEAASALGIKGIHVVDRQTVPDYFKEIGF 201
50118994  161 AVFFDDNSANVDAAQSLGIHSILVTDRQVVTDFFAMQAI 199
271502628 161 ALFFDDNAANVEAANALGIRSILVSDRQVVPDFFASQVF 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap