Conserved Protein Domain Family
PTZ00191

?
PTZ00191: PTZ00191 
60S ribosomal protein L23a; Provisional
Statistics
?
PSSM-Id: 185507
View PSSM: PTZ00191
Aligned: 34 rows
Threshold Bit Score: 152.547
Threshold Setting Gi: 124513236
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
294894004   1 MAPATDAKSKASKTGAALTKGVQVKTRKVRKNTTFFRPKTRQTPKAPKYPR--SATPT-LTKMDKYRIIRSPMTSEWAMK 77 
66800347   25 IKAPAAAIKAKAAASAVKKGVSNKSTRKVRTSVIFRRPVTLNNPKKPAYPR--RSVNK-ITKMDQFRILKAPLTTESATQ 101
145480173   2 PKGQTTTTQKAQKAAKNARVAKKVIRARTHFQNRFHTAKPLALARKPRFTRltRQLKPiTKGLDFQNVLKHPLITEKDMK 81 
145480689   2 PKGQTTNTQKAQKAAKNARVAKKVVRARKHFQNRFHTEKPLALSRKPKFTRltRQLTPvSKGLDFQNVLRHPLITEKDMK 81 
145531970   2 PKGQTTTTQKAQKAAKNTRVAKKVVRARKHFQNRFHTTKPLALARKPKFTRltRQLKPiTKGLDFQNVLKHPLITEKDMK 81 
145528786   2 PKGQTTTTQKAQKAAKNARVTKKVVRARKHFQNRFHTAKPLALTRKPKFTRltRQLKPiTKGLDFQNVLKHPLITEKDMK 81 
145547493   3 KGQTTTTTQKAQKAAKNARVAKKVIRARTHFQNRFHTAKPLALARKPRFTRltRQLKPiTKGLDFQNVLKHPLITEKDMK 82 
145547775   2 PKGQTTNTQKAQKAAKNARVAKKVVRARKHFQNRFHTEKPLALSRKPRFTRltRQLAPvSKGLDFQNVLRHPLITEKDMK 81 
159111823   1 ----MSEKAQALKAQKAILHGTRVEAKKIRTNVHFFRPKTLVHKKAPLYPR--NPIKK-GSWDDPCDLLRYPIKTDENTT 73 
118372960   3 KENKTQAVNKAKNTAKVAKKGSSITKHKTYTGVRFFRPKTLQLAKAPKYSRtvRAHLKvSGHLDNHSVVKTPLTTEKAMK 82 
294894004  78 HIEDLNTLVFLCDIQATKQQIRDAVESLYDIKCKKVNTLVRHDGLKKAYVKLADDFDALDVGNRSvssnqlrGYH 152
66800347  102 KIEGSNTITFMVDMFANKSQVADAVAKMYDVKVKRVNTLITPRGEKKAFVTLSPEFEAADVANKI-------GLI 169
145480173  82 KMEDENTMVFYVNQKATKPQIKRAFSKIYEVKVRKVNILNTFGGKKKAYIRLGGENDALNLANKI-------GII 149
145480689  82 KMEDENTMVFYVNQKSTKPQIKRAFQKIYEVKVRKVNILNTFGGKKKAYIRLGGENDALNLANKI-------GII 149
145531970  82 KMEDENTMVFYVNQKSTKPQIKRAFSKIYEVKVRKVNILNTFGGKKKAYIRLGGENDALNLANKI-------GII 149
145528786  82 KMEDENTMVFYVNQKSTKPQIKRAFSKIYEVKVRKVNILNTFGGKKKAYIRLGGENDALNLANKI-------GII 149
145547493  83 KMEDENTMVFYVNQKATKPQIKRAFSKIYEVKVRKVNILNTFGGKKKAYIRLGGENDALNLANKI-------GII 150
145547775  82 KMEDENTMVFYVNQKSTKPQIKRAFQKIYEVKVRKVNILNTFGGKKKAYIRLGGENDALNLANKI-------GII 149
159111823  74 QIEKNNTIVFIVDRRASKPEIRKAFETVFETKVARVNTLITPLGLKKAFIRLAPDVQAMDVASKM-------GLA 141
118372960  83 KMEDENTMVFYVHNRSTKPQIKSAFEKLYNVKVRSVNTLNTITGNKKAYIRLAADSDSLTLANKI-------GLI 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap