Conserved Protein Domain Family
PTZ00253

?
PTZ00253: PTZ00253 
tryparedoxin peroxidase; Provisional
Statistics
?
PSSM-Id: 140280
View PSSM: PTZ00253
Aligned: 20 rows
Threshold Bit Score: 406.598
Threshold Setting Gi: 71413203
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71413203    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALSSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80 
71413207    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALSSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80 
71403567    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALTSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80 
71399514    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALSSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80 
71396508    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALTSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80 
71744678    1 MSCGDAKLNHPAPHFNEVALMPNGTFKKVDLASYRGKWVVLFFYPLDFTFVCPTEICQFSDRVKEFNDVDCEVIACSMDS 80 
154334618   1 MSCGDAKMNEPAPPFEEMALMPNGSFKKITLASYKGKWVVLFFYPLDFTFVCPTEIIQFSDSIKRFNELDCEVMSCSVDS 80 
154334622   1 MSCGDAKMNEPAPPFEEMALMPNGSFKKINLASYKGKWVVLFFYPLDFTFVCPTEIIQFSDSIKRFNELDCEVMSCSVDS 80 
157866934   1 MSCGNAKINSPAPSFEEVALMPNGSFKKISLSSYKGKWVVLFFYPLDFTFVCPTEVIAFSDSVSRFNELNCEVLACSIDS 80 
157866942   1 MSCGNAKINSPAPSFEEVALMPNGSFKKISLSSYKGKWVVLFFYPLDFSFVCPTEVIAFSDSVSRFNELNCEVLACSIDS 80 
71413203   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
71413207   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
71403567   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
71399514   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
71396508   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
71744678   81 EFSHLAWTNVERKKGGLGTMNIPILADKTKSIMKAYGVLKEEDGVAYRGLFIIDPQQNLRQITINDLPVGRNVDETLRLV 160
154334618  81 EYAHLQWTLQERKKGGLGPMEIPMLADKTKCICRAYGVLDEKKGVAYRGLFIIDPKGILRQIIVNDMPVGRNVEEALRLL 160
154334622  81 EYAHLQWTLQERKKGGLGPMEIPMLADKTKCICRAYGVLDEKKGVAYRGLFIIDPKGILRQIIVNDMPVGRNVEEALRLL 160
157866934  81 EYAHLQWTLQDRKKGGLGTMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMLRQITVNDMPVGRSVEEVLRLL 160
157866942  81 EYAHLQWTLQDRKKGGLGTMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMLRQITVNDMPVGRSVEEVLRLL 160
71413203  161 KAFQFVEEHGEVCPANWKPGDKTMKPDPEKSKEFFGAVA 199
71413207  161 KAFQFVEEHGEVCPANWKPGDKTMKPDPEKSKEYFGAVA 199
71403567  161 KAFQFVEKHGEVCPANWKPGDKTMKPDPEKSKEYFGAVA 199
71399514  161 KAFQFVEKHGEVCPANWKPGDKTMKPDPEKSKEYFGAVA 199
71396508  161 KAFQFVEKHGEVCPANWKPGDKTMKPDPEKSKEYFGAVA 199
71744678  161 KAFQFVEKHGEVCPANWKPGSKTMKADPNGSQDYFSSMN 199
154334618 161 EALQFVEKHGEVCPANWKKGDATMKPERQASIEGYFSTV 199
154334622 161 EALQFVEKHGEVCPANWKKGDATMKPERQASIEGYFSKQ 199
157866934 161 EAFQFVEKHGEVCPANWKKGAPTMKPEPNASVEGYFSKQ 199
157866942 161 EAFQFVEKHGEVCPANWKKGAPTMKPEPNASVEGYFSKQ 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap