Conserved Protein Domain Family
phage_LysB

?
TIGR03495: phage_LysB 
phage lysis regulatory protein, LysB family
Members of this protein family are phage lysis regulatory protein, including the well-studied protein LysB (lysis protein B) of Enterobacteria phage P2. For members of this family, genes are found in phage or in prophage regions of bacterial genomes, typically near a phage lysozyme or phage holin.
Statistics
?
PSSM-Id: 274606
Aligned: 10 rows
Threshold Bit Score: 103.636
Threshold Setting Gi: 17313230
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_490610      8 LYSAALLGALG--LLLWVQQQRIDLAQARLAQAELARKASDAQLSRQAGTITALEAALSRERQAQADLDQQRQQLRQALA 85  Pseudomonas pha...
P51770         6 IVLVVLLSLAV--AGLFLVKHKNASLRASLDRANNVASGQQTTITMLKNQLHVALTRADKNELAQVALRQELENAAKREA 83  Enterobacteria ...
NP_958066      2 KALITLLVLAV--LGLFWLRHENGNLRTSFEKANRVASKQKTTIGMLTNQLSVAGQLARRNESAQVALREQLAKAGAEAN 79  Enterobacteria ...
WP_011094160   7 DWRIVVFFLLV--AGAGLQSWRLDHSQKLNSQQEKTLKQQRDALEEKSGQLNALTEQIKRSDEDQARLRDLVEQNRAALS 84  Pectobacterium ...
AHJ74555       3 RTLVMVLV-LL--AALGWQSWRLNNASHTIETQGATLASQAQELAKKNSQLIGLSILTETNSREQTRLYAAAEQTTALLR 79  Enterobacter cl...
WP_011192214   2 RTAIMLIVTLL--AALGWYASR---LSDDIDNANRIIGTLSAGIESRDNAITRLQAEARQQAENERALRQSLSDASTLSL 76  Yersinia pseudo...
WP_001589059   1 mnrlllvvlalllaalGWQTWRLADASQTISTQSDELQSKSQALAKSNSQLISLSILTETNNREQARLYAEAEQTSALLR 80  Escherichia coli
WP_011506692  14 KIWLVLIGTGVvgAGGWFAWQEYRTALTDAASARQALDAAQAENAQRQLVIDVLWQNAQRLEEQRQQLNDTKADLERTAS 93  Chromohalobacte...
WP_011192309   6 taplawaiaaalllaGGVQTYRLSEARQVMIDQ------QAAEVASKNGQLIALALTANANNQAQAQLRQQVASTDQLLA 79  Yersinia pseudo...
WP_009897046   5 RLMPWLALFAL--IALAASCQHGRALRAQLERATDDARRANRDAQASAAVIERLLADAKAKDAQREQLDRARAGVDATLA 82  Burkholderia th...
NP_490610     86 IRERLIEDLKRDDEPYRQWADQPLPDVARRLQQRPAITGAAAYHQWLSRRDALQPGV 142 Pseudomonas phage phiCTX
P51770        84 QREKTITRLLNENEDFRRWYGADLPDAVRRLHQRPACTDASDCPQRMPESEPLPDAG 140 Enterobacteria phage P2
NP_958066     80 RREQTITRLLDENEAFRRWYNAPLPDAVRRLHTRAACASAGDCGQRMPEGEPLPDAG 136 Enterobacteria phage PsP3
WP_011094160  85 DRQKLIERLKRENQELKHWADTLLPADIVRLRQRPAITGGSAYRKWLSEVDAVPVPG 141 Pectobacterium atrosepticum
AHJ74555      80 SRQHRIEELKRENEDLRRWADTPLPADIIRLRERPALAGGAAYREWLSGSDAVPAGK 136 Enterobacter cloacae subsp. dissolvens...
WP_011192214  77 SREQKIQRLLNENKVLRDWFATALPADVIRLHQRPAFASPNGYLRWLSDGEQLPATG 133 Yersinia pseudotuberculosis
WP_001589059  81 QRQHRIEELKRENEDLRRWADTPLPADIIRLRERPTLTGGAAYRQWLSASDAVSAGA 137 Escherichia coli
WP_011506692  94 NRLTRLRELIHENAELRAWAGTRLPDAVIRLRERPAVTGATDYRQALRDTQPMQPPR 150 Chromohalobacter salexigens
WP_011192309  80 QRNSQIKRLYRENETLRRWADTPLPDDIIRLRQRPALTGAADYRQWLSESGTVPVSG 136 Yersinia pseudotuberculosis
WP_009897046  83 TYRNELRRLIDENAAVRTWAAGALPDDVVRLHASPALNGADDYAQRVRGGDALHDAG 139 Burkholderia thailandensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap