2HAN,3DZU,1YNW,1BY4,1DSZ,1BY4,1R0O,1RXR,1R0N


Conserved Protein Domain Family
NR_DBD_RXR

?
cd06956: NR_DBD_RXR 
Click on image for an interactive view with Cn3D
DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers
DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer. RXRs can play different roles in these heterodimers. RXR acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear receptors. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, RXR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Statistics
?
PSSM-Id: 143514
View PSSM: cd06956
Aligned: 20 rows
Threshold Bit Score: 124.197
Threshold Setting Gi: 159162954
Created: 21-Nov-2008
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:zinc binding site [ion binding site]
Evidence:
  • Structure:3DZU_A; Zn binding site of human Rxr Alpha Nuclear Receptor Complex, defined by 3.5A distance
    View structure with Cn3D
  • Comment:Zinc finger, C4-type: The domain contains two groups of four Cys residues. Each group is involved in the co-ordination of a single zinc atom.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           #  #             #  #               #     #         #  #                   
2HAN_A         11 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCRYQKCLTCGMKREAVQEER 87   fruit fly
3DZU_A        138 HICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEER 214  human
AAL86461      115 HICAICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACRDDKNCMIDKRQRNRCQYCRYMKCLSMGMKREAVQEER 191  bloodfluke planorb
NP_001071809  167 HICAVCGDRASGKHYGVYSCEGCKGFFKRTVRKYLTYTCRDDKDCIIDKRQRNRCQYCRYQKCITMGMKKEAVQEER 243  Ciona intestinalis
P51128        159 HICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDSKDCMIDKRQRNRCQYCRYQKCLAMGMKREAVQEER 235  African clawed frog
BAF91724      102 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACREDRNCVIDKRQRNRCQYCRYQKCLSCGMKREAVQEER 178  Ornithodoros mou...
AAM08268      127 HICAICGDRASGKHYGVYSCEGCKGFFKRTVRKDLIYLCRENRNCIIDKRQRNRCQYCRYRKCQSMGMKREAVQEER 203  dog heartworm ne...
XP_001188861  131 SICAVCGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDDRNCMVDKRQRNRCQYCRYQKCLGMGMRREAVQEER 207  purple urchin
EEC07894       80 HLCSICGDRASGKHYGVYSCEGCKGFFKRTVRKDLTYACREERNCIIDKRQRNRCQYCRYQKCLSCGMKREAVQEER 156  black-legged tick
AAD33428      913 YICSICSDRASGKHYGVFSCEGCKGFFKRTVRKELTYICRDSQECQIDKRLRNRCQYCRYQKCLRAGMRREAVQEER 989  Schistosoma mansoni

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap