Conserved Protein Domain Family
M48B_HtpX_like

?
cd07338: M48B_HtpX_like 
Peptidase M48 subfamily B HtpX-like membrane-bound metallopeptidase
This HtpX family of peptidase M48 subfamily B includes uncharacterized HtpX homologs and consists of proteins smaller than Ste24p, with homology restricted to the C-terminal half of Ste24p. HtpX expression is controlled by the Cpx stress response system, which senses abnormal membrane proteins. HtpX participates in the proteolytic quality control of these misfolded proteins by undergoing self-degradation and collaborating with FtsH, a membrane-bound and ATP-dependent protease, to eliminate them. HtpX, a zinc metalloprotease with an active site motif HEXXH, has an FtsH-like topology, and is capable of introducing endoproteolytic cleavages into SecY (also an FtsH substrate). However, HtpX does not have an ATPase activity and will only act against cytoplasmic regions of a target membrane protein. Thus, HtpX and FtsH have overlapping and/or complementary functions, which are especially important at high temperature; in E. coli and Xylella fastidiosa, HtpX is heat-inducible, while in Streptococcus gordonii it is not.
Statistics
?
PSSM-Id: 320697
View PSSM: cd07338
Aligned: 36 rows
Threshold Bit Score: 206.278
Threshold Setting Gi: 442790629
Created: 25-Feb-2009
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Zn binding siteputative active
Feature 1:Zn binding site [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
Q9YD67        40 LLALAMVLVQWLFSPYIINmvyrtre---------plpgeeWIVAEVEQLARRSGLKPPKVVVSEMnmPNAFAYGSpi-a 109 Aeropyrum perni...
KCZ70998      40 ILASFMMFIQYMLGPKMVEwsmgvky--------vneqeypALHRMVAELARDARIPKPKIGIARIpiPNAFAFGRwa-k 110 Candidatus Meth...
AJZ76048      40 GMGIFMGLIQWLIGPKIIRwstnlrt--------lspgelpWVEQTVREICAKNNVKVPQITIANNgmPNAFVFGRts-n 110 Thaumarchaeota ...
EET89986      49 LVALAYFIIQWYVSPKILAaasklhy--------itgneypQIQQFVKSAADSAKVPVPRIAIAPAkdPNAFVFGRtr-r 119 Candidatus Micr...
KKK43121      38 GFTLLIILFQYGISPLIVGwlysidwip----yeefarqypHLADSLDKVVAVNGIKVPRLGIIHDlnPNAFTFGWsk-n 112 archeaon Loki
AAO35737      43 GFSVSIALIQFLLGPFIIEtfygilfd------dydsyiseDVLRFIEKSCDGYNISHPKIGIIEDgnPNAFTFGHip-r 115 Clostridium tet...
KJE21883      29 AGGVSVVAVQYLVAPWVIAwlvpatelar---tadgyrsdePVAAIVARQCQAAGLPLVRLGIVDDgdPNAFTFGRtr-r 104 Frankia sp. CpI1-S
AIE87657      20 GFAILMVLLQYALGPVVIDavvkirwt-------spmelgpDFDLWLRQTCATFKIPTPKFGIIEEgsPNAFTYGNgp-w 91  Fimbriimonas gi...
ELS00182     286 IVTVLINLIVFWLSPQIIDfiqarlysirwvpiteigyhssETAEVIERICSKYQLKTPRLGVIDQpiPIAFSYGAfphh 365 Gloeocapsa sp. ...
WP_020087772  40 VLVLIINAVIFFISPWITDwmlrwvnkvefiddatlksrypHVHGIIHDVAREYRFKAPSVGIIPDrnPTAFTYGLfr-p 118 Hyphomicrobium ...
Feature 1                                #   #                                                   
Q9YD67       110 GSYVAVTRGLLrllpkDEVRAVLAHEVGHLKHRDVTVILALS-LIPIAAFLIGRTLVwagilggggg----errgnpmal 184 Aeropyrum perni...
KCZ70998     111 DGRVCVTEGIMnllneRELRAVLAHEVSHLKHRDVAVITMIS-VIPMIAWYLAWNSLfsggrd-------------rgnn 176 Candidatus Meth...
AJZ76048     111 SATLALTQGLLnnltqDEVKGVIAHEIGHIKHHDMLVMTIVS-VVPTIAYYIAMSTMfsgrshr----------nqvgga 179 Thaumarchaeota ...
EET89986     120 SATLVIHEGLLarlnsDELKAVIEHEIGHLRHNDVIIMTMVA-FIPMLAFIIAQNILwagmfnds--------rnsssyi 190 Candidatus Micr...
KKK43121     113 SARVVITDGILeylneKEQNAVFSHELGHVVHSDFIIMTIVF-AIPLVLLTVARWAYyagwysgrrrssddegnllglil 191 archeaon Loki
AAO35737     116 NARLVVTTGLLdilneEEQKAVIAHELGHIKHYDFITMMIVS-LIPMILYQIYLRTKekka----------------dak 178 Clostridium tet...
KJE21883     105 DSRVWISRGLLdrlddREVEAVVAHELGHVAHRDVAVMTVAS-LIPMVLYFATAGGRaangs---------------ggn 168 Frankia sp. CpI1-S
AIE87657      92 NARVVVTRGVIdalepEELKAVVAHELGHVRNRDFIVMTIVQ-ALVLALYSLYIASRyagr----------------rng 154 Fimbriimonas gi...
ELS00182     366 QTRLVVSQGLFayldeEEIATVYAHELGHIVNKDLMIMTLGYgFMAIINLIRARWDKpl--------------------- 424 Gloeocapsa sp. ...
WP_020087772 119 GARIVLTDGIFeflneEETRAVVAHELGHIVNRDFLVMTVAG-TLVQMLYVIYSSLTrqtrssgs--------sksknnl 189 Hyphomicrobium ...
Feature 1                                 #                                                      
Q9YD67       185 vAVGAALLAAGMVFQlivshFNRLREYYADAHSALVTGsprsLQRALARIHAAYehnphlveearsnemasmlfivapl- 263 Aeropyrum perni...
KCZ70998     177 iLIGIAAFAVYFLTNllvlyVSRIREYSADEGAVKLGNsphqLASALYKLVYGSaripkeslkqvegmkaffasdpsras 256 Candidatus Meth...
AJZ76048     180 aMIGIGAFVVYFITNlmvlhFSRLREFYADRFAGQQIKpt-hLASALAKITYGLsiqkqnmqnsslrafyavdpvassle 258 Thaumarchaeota ...
EET89986     191 mLLGVVAFIVYFVAEmlmlsLSRARESYADSYSASATKkpgdLASALLKITASGaaapassnnstvarslyivdffnvek 270 Candidatus Micr...
KKK43121     192 iAVAVLAYISYYLGYlisliVSRIREYYADEHSAEVLEdpnaLATGLVKIAYGLlmdanngqvkernrsrvralrglgif 271 archeaon Loki
AAO35737     179 yIVGLGAYAAYLLSGflvlgFSRMREYYSDNFAKEVMGdgehLRNALVKIAYGTasrekdknpkascmaftnnvqndswm 258 Clostridium tet...
KJE21883     169 dVNRLLAFAAYLVAQlallgFARARELGADHASCRATGdgdaLCSALVRIAYGIdevgreraariaalraddekrqarrl 248 Frankia sp. CpI1-S
AIE87657     155 gYVAVLSFIAYQLSYyisllLSRVREYMADYASAQIMSngndLSSALVKIAYGMgrlqtaspaqqpvsyspqpypspayq 234 Fimbriimonas gi...
ELS00182     425 fPAFIYTLATYSLFY-----LSRTREYHADHIATQITGnpnaLIRALTKIAYGIveenersekvsnllretrvlgiydpy 499 Gloeocapsa sp. ...
WP_020087772 190 aIVGFAAYVMYVLGTyillyLSRTREYLADSFAADRVEar-hLANALVKIAYGIaeaadtdqtrellastrhmgvvdfkg 268 Hyphomicrobium ...
Feature 1                                                                                        
Q9YD67           -------------------------------------------------------------------------------- Aeropyrum perni...
KCZ70998     257 reirel-------------------------------------------------------------------------- 262 Candidatus Meth...
AJZ76048     259 vsr----------------------------------------------------------------------------- 261 Thaumarchaeota ...
EET89986     271 dikdlk-------------------------------------------------------------------------- 276 Candidatus Micr...
KKK43121     272 dpnaak-------------------------------------------------------------------------- 277 archeaon Loki
AAO35737     259 l------------------------------------------------------------------------------- 259 Clostridium tet...
KJE21883     249 arrgarlrstga-------------------------------------------------------------------- 260 Frankia sp. CpI1-S
AIE87657     235 avatarpgqiilppvgvnqappvqpapppamgndrvtpdlmaklasiqhqgdvrsgaaasqdfaaqllggqaqaragkqp 314 Fimbriimonas gi...
ELS00182     500 l------------------------------------------------------------------------------- 500 Gloeocapsa sp. ...
WP_020087772 269 ash----------------------------------------------------------------------------- 271 Hyphomicrobium ...
Feature 1                                                                      #            
Q9YD67       264 ------------------------------tsltasplvdvdylverlkeqetnpLVELFSTHPPvsKRLRFLDR 308 Aeropyrum pernix K1
KCZ70998     263 ------------------------sqidldgsgtidatelaalrtrpikvntadkLMEMLSTHPNmlKRIQRLSS 313 Candidatus Methanope...
AJZ76048     262 --------------------------fasyyldlhisekevqdamdwerrnsfskFGELFRTHPLtyKRIAKLYE 310 Thaumarchaeota archa...
EET89986     277 -----------------------thineikelvpdidinrlvsearknrggplnaLNSMFATHPPtyKRIVDLAR 328 Candidatus Micrarcha...
KKK43121     278 -----------------------glgiisvsstkvlsmeaiqaaaawdlfnpwakYYQFRSTHPLpaKRIMRLNA 329 archeaon Loki
AAO35737     260 -----------------------------styklddnnkmklnlmkwdlknpwakWYEINSTHPLtgKRIMALDH 305 Clostridium tetani E88
KJE21883     261 -----------------lgiagpgglpaagllgpglpperiaaamrwentspwarWQELFATHPLvvHRIAALER 318 Frankia sp. CpI1-S
AIE87657     315 knpapsfdaralgafgiagaasmrsavtwggqqgtvdpdhftmgarwelynpwarIAELVSTHPLtvRRIQALQK 389 Fimbriimonas ginseng...
ELS00182     501 ----------------------------alatgivteaknlgktlvwdmfnpwanWVQLNATHPLtgKRFAALTD 547 Gloeocapsa sp. PCC 7...
WP_020087772 272 --------------------------lglvveasklhpeatanamlfdiynpwakLIELSSTHPLtgKRINALAA 320 Hyphomicrobium zavar...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap