1LKX,2DFS,2XO8,1I84,6QDJ


Conserved Protein Domain Family
Myosin_head

?
pfam00063: Myosin_head 
Click on image for an interactive view with Cn3D
Myosin head (motor domain)
Statistics
?
PSSM-Id: 395017
View PSSM: pfam00063
Aligned: 16 rows
Threshold Bit Score: 974.45
Threshold Setting Gi: 353526351
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LKX_A   10 VPDFVLLNQITENAFIENLTMRHK-SDNIYTYIGDVVISTNPFKNLN-IYKESDIKAYNGRY------------KYEMPP 75   Dictyostelium disco...
P22467   14 VEDLIMLTEVSESSLHENLKIRYK-EGLIYTSIGPVLVSMNPYKQLG-IYGNDQINLYKGKH------------EFEIPP 79   Dictyostelium disco...
P34092   11 TDDLVMLPKVSEDEICENLKKRYM-NDFIYTNIGPVLISVNPFRNLN-NSGPDFIEAYRGKH------------AQEVPP 76   Dictyostelium disco...
P19524   72 TEDLTSLSYLNEPAVLHAIKQRYS-QLNIYTYSGIVLIATNPFDRVDqLYTQDMIQAYAGKR------------RGELEP 138  Saccharomyces cerev...
P10568   10 VEDLVLLEPLEQESLIRNLQLRYE-KKEIYTYIGNVLVSVNPYQQLP-IYDLEFVAKYRDYT------------FYELKP 75   cattle
Q01989   59 HDDNCELMLLNEATFLDNLKTRYY-KDKIYTYVANILIAVNPYREIKeLYAPDTIKKYNGRS------------LGELPP 125  fruit fly
2DFS_M   71 ENDLTALSYLHEPAVLHNLKVRFIdSKLIYTYCGIVLVAINPYEQLP-IYGEDIINAYSGQN------------MGDMDP 137  chicken
P32492   73 TDDLTTLSYLNEPAVLHAIKKRYM-NGQIYTYSGIVLIAANPFDKVDhLYSREMIQNYSSKR------------KDELEP 139  Saccharomyces cerev...
P08964   77 VENMSELTHLNEPSVLYNLEKRYD-CDLIYTYSGLFLVAINPYHNLN-LYSEDHINLYHNKHnrlsksrldensHEKLPP 154  Saccharomyces cerev...
P12844   88 TEDMANLTFLNEASVLGNLKDRYK-DLMIYTYSGLFCVVINPYKRLP-IYSESVIKHFMGKR------------RNEMPP 153  Caenorhabditis elegans
1LKX_A   76 HMYALANDAYRSMRQSQENQCVIISGESGAGKTEASKKIMQFLTFVSSNQSp---------NGERISKMLLDSNPLLEAF 146  Dictyostelium disco...
P22467   80 HIYSIADKAYRALRSEGENQCIIISGESGAGKTEASKYIMQYIASITGSST----------EVERVKKTILESNPLLEAF 149  Dictyostelium disco...
P34092   77 HVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAISGSTE----------KVEYVKHVILESNPLLEAF 146  Dictyostelium disco...
P19524  139 HLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSatvq---hqvEMSETEQKILATNPIMEAF 215  Saccharomyces cerev...
P10568   76 HIYALANMAYQSLRDRDRDQCILITGESGAGKTEASKLVMSYVAAVCGKGEq--------vN--SVKEQLLQSNPVLEAF 145  cattle
Q01989  126 HVFAIADKAIRDMRVYKLSQSIIVSGESGAGKTESTKYLLKYLCYSHDSAG-------------PIETKILDANPVLEAF 192  fruit fly
2DFS_M  138 HIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSAS-----------EANVEEKVLASNPIMESI 206  chicken
P32492  140 HLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNreg-----evEMSQIESQILATNPIMEAF 214  Saccharomyces cerev...
P08964  155 HIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPsniapvsgssIVESFEMKILQSNPILESF 234  Saccharomyces cerev...
P12844  154 HLFAVSDEAYRNMVQDKENQSMLITGESGAGKTENTKKVISYFAIVGATQAasgkeakdgkKGGTLEEQIVQTNPVLEAF 233  Caenorhabditis elegans
1LKX_A  147 GNAKTLRNDNSSRFGKYMEMQFNAVGSPIGGKITNYLLEKSRVVGRTQGERSFHIFYQMLKGLSQSKLDELGLTp-NAPA 225  Dictyostelium disco...
P22467  150 GNAKTLRNNNSSRFGKYMEIQFNLGGDPEGGKITNYLLEKSRVINQTQGERNFHIFYQLLKGSSEEEKKTYNLL--SPDQ 227  Dictyostelium disco...
P34092  147 GNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNYLLEKSRVVYQNPGERNFHIFYQLLAGASAQEKRDYVLS--SPES 224  Dictyostelium disco...
P19524  216 GNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLT--DASD 293  Saccharomyces cerev...
P10568  146 GNAKTIRNNNSSRFGKYMDIEFDFKGFPLGGVITNYLLEKSRVVKQLEGERNFHIFYQLLAGADAQLLKALKLEr-DTGG 224  cattle
Q01989  193 GNAKTTRNNNSSRFGKFIEVHYDAKCQVVGGYISHYLLEKSRICTQSAEERNYHVFYMLLAGAPQQLRDKLSLG--KPDD 270  fruit fly
2DFS_M  207 GNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLG--NANY 284  chicken
P32492  215 GNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLS--SPKD 292  Saccharomyces cerev...
P08964  235 GNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLKsrNVKD 314  Saccharomyces cerev...
P12844  234 GNAKTVRNNNSSRFGKFIRTHFSGSGKLAGGDIEHYLLEKSRVVRQAPGERCYHIFYQIMSGNDPSLRGKLKLSn-DITY 312  Caenorhabditis elegans
1LKX_A  226 YEYLKKSG---CFDV-------------------------STIDDSGEFKIIVKAMETLGLKESDQNSIWRILAAILHIG 277  Dictyostelium disco...
P22467  228 YHYLTRNAsngCFTA-------------------------DGIDDQIGFKQTKNAMKVVGIDEPLQKEIFATLSAILLLG 282  Dictyostelium disco...
P34092  225 YYYLNQSQ---CYTV-------------------------DGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIG 276  Dictyostelium disco...
P19524  294 YFYMNQGG---DTKI-------------------------NGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIG 345  Saccharomyces cerev...
P10568  225 YAYLNPD----TSRV-------------------------DGMDDDANFKVLQSAMTVIGFSDEEIRQVLEVAALVLKLG 275  cattle
Q01989  271 YRYLSGCT---QYFAnakteqlipgsqksknhqqkgplkdPIIDDYQHFHNLDKALGRLGLSDTEKLGIYSLVAAVLHLG 347  fruit fly
2DFS_M  285 FHYTKQGG---SPVI-------------------------DGIDDAKEMVNTRQACTLLGISDSYQMGIFRILAGILHLG 336  chicken
P32492  293 YHYTNQGG---QPNI-------------------------AGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIG 344  Saccharomyces cerev...
P08964  315 YKILSNSN---QDII-------------------------PGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIG 366  Saccharomyces cerev...
P12844  313 YHFCSQ-A---ELTI-------------------------EGMDDKEEMRLTQEAFDIMGFEDNETMDLYRSTAGIMHMG 363  Caenorhabditis elegans
1LKX_A  278 NITFAEAA--EQRtGtttvKVSDTKS-LAAAASCLKTDQQSLSIALCYRSISTGvg----krCSVISVPMDCNQAAYSRD 350  Dictyostelium disco...
P22467  283 NLSFNKSA--SGNgS----VISDKKL-ANTIASLMGVDAIVLESSLVSRQISTGqg----arISTYSVPQTVEQAMYARD 351  Dictyostelium disco...
P34092  277 NIYFIEDD--KGNaA----IYDPNA--LELAASMLCIDSATLQNAILFRVINTGgaggagnrRSTYNVPQNVEQANGTRD 348  Dictyostelium disco...
P19524  346 NIEIKKTR--NDA-S----LSADEPN-LKLACELLGIDAYNFAKWVTKKQIITR--------SEKIVSNLNYSQALVAKD 409  Saccharomyces cerev...
P10568  276 NVELINEFqaNGVpA----SGIRDGRgVQEIGELVGLNSVELERALCSRTMETA--------KEKVVTTLNVIQAQYARD 343  cattle
Q01989  348 NIAFEEIP--DDVrGgc-qVSEASEQsLTITSGLLGVDQTELRTALVSRVMQSKggg---fkGTVIMVPLKIYEASNARD 421  fruit fly
2DFS_M  337 NVEFASRD--SDScA----IPPKHDP-LTIFCDLMGVDYEEMAHWLCHRKLATA--------TETYIKPISKLHAINARD 401  chicken
P32492  345 NIEMKMTR--NDA-S----LSSEEQN-LQIACELLGIDPFNFAKWIVKKQIVTR--------SEKIVTNLNYNQALIARD 408  Saccharomyces cerev...
P08964  367 NIEFVSDR--AEq-A----SFKND---VSAICSNLGVDEKDFQTAILRPRSKAG--------KEWVSQSKNSQQAKFILN 428  Saccharomyces cerev...
P12844  364 EMKFKQRP--REEqA----EPDGEED-ALNAAAMLGIQAEEFLKALTKPRVRVG--------TEWVNKGQNLEQVNWAVS 428  Caenorhabditis elegans
1LKX_A  351 ALAKALYERLFNWLVSKINTIINCTTe-----KGPVIGILDIYGFEVFQNNSFEQLNINFCNEKLQQLFIELTLKSEQEE 425  Dictyostelium disco...
P22467  352 AFAKATYSKLFDFIVRKINQSIEVKT------IGKVIGVLDIYGFEIFENNSFEQFCINYVNETLQQIFIDLTLKTEQEE 425  Dictyostelium disco...
P34092  349 ALARTIYDRMFSWLVERVNQSLSYYKs----pYQNVIGILDIFGFEIFEKNGFEQFCINFVNEKLQQFFIELTLKAEQEE 424  Dictyostelium disco...
P19524  410 SVAKFIYSALFDWLVENINTVLCNPAvn--dqISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 487  Saccharomyces cerev...
P10568  344 ALAKNIYSRLFNWLVNRINESIKVGTg----eKRKVMGVLDIYGFEILEDNSFEQFVINYCNEKLQQVFIEMTLKEEQEE 419  cattle
Q01989  422 ALAKAIYSRLFDRIVGLINQSIPFQA------SNFYIGVLDIAGFEYFTVNSFEQFCINYCNEKLQKFFNDNILKNEQEL 495  fruit fly
2DFS_M  402 ALAKHIYANLFNWIVDHVNKALHSTVk-----QHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEE 476  chicken
P32492  409 SVAKFIYSTLFDWLVDNINKTLYDPEldqqdhVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEE 488  Saccharomyces cerev...
P08964  429 ALSRNLYERLFGYIVDMINKNLDHGSa-----TLNYIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSE 503  Saccharomyces cerev...
P12844  429 GLAKAIYARMFKWIITRCNKTLDAKEi----eRKHFIGVLDIAGFEIFDLNSFEQLWINFVNERLQQFFNHHMFVLEQEE 504  Caenorhabditis elegans
1LKX_A  426 YVREGIEWKNIEYf-NNKPICELIEKk--pIGLISLLDEACLIAKS----TDQTFLDSICKQF-EKNP---HLQSY-Vvs 493  Dictyostelium disco...
P22467  426 YVQEGITWIPVQYi-NNKACVDLIEKk--pIGILSLLDEECLFPEG----NDQTMIDKLNKHF-SNHT---HYSKV-Er- 492  Dictyostelium disco...
P34092  425 YVREGIKWEPIKYf-NNQIVCDLIEGks-pPGIFSLLDDICSTLHAqstgTDQKFLEKMAGIY-DGHL---HWr------ 492  Dictyostelium disco...
P19524  488 YVKEEIEWSFIEFn-DNQPCIDLIENk---LGILSLLDEESRLPAG----SDESWTQKLYQTL-DKSPtnkVFSKP-R-- 555  Saccharomyces cerev...
P10568  420 YKREGIPWVKVEYf-DNGIICNLIEHn--qRGILAMLDEECLRPGVv---SDSTFLAKLNQLF-SKHS---HYESKvTqn 489  cattle
Q01989  496 YKREGLNVPEITFt-DNQDIIELIEAk--sNGIFTLLDEESKLPKP----SYSHFTAEVHKSW-ANHYr-lGLPRSsRlk 566  fruit fly
2DFS_M  477 YMKEQIPWTLIDFy-DNQPCINLIEAk---MGVLDLLDEECKMPKG----SDDTWAQKLYNTHlNKCA---LFEKP-R-- 542  chicken
P32492  489 YVKEEIEWSFIEFs-DNQPCIDLIENk---LGILSLLDEESRLPSG----SDESWASKLYSAF-NKPPsneVFSKP-R-- 556  Saccharomyces cerev...
P08964  504 YLKENIQWDYIDYgkDLQLTIDLIESkgppTGVLPLLDEEAVLPKS----TDESFYSKLISTWdQNSS---KFKRS-Rl- 574  Saccharomyces cerev...
P12844  505 YKREGIAWTFIDFglDLQACIELIEKp---LGIISILDEECIVPKA----TDMTYAQKLLDQHlGKHP---NFQKP-Kpp 573  Caenorhabditis elegans
1LKX_A  494 k----drsIGDTCFRLKHYAGDVTYDVRGFLDKNKDTLFGDLISSMQSSSD-PLVQGLFPP------------------- 549  Dictyostelium disco...
P22467  493 --------QKNSQFIINHYAGKVFYNIDGFLDKNRDTLFNDLVTLATSSSC-SLLVEIFKYvpplevdpeqekknrdkfs 563  Dictyostelium disco...
P34092  493 --------GMTGAFAIKHYAGEVTYEAEGFSDKNKDTLFFDLIEAIQCSKM-PFLASLFNEd------------------ 545  Dictyostelium disco...
P19524  556 --------FGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTN-ETLINILEGlekaakkleea-------k 619  Saccharomyces cerev...
P10568  490 aqrqydhsMGLSCFRICHYAGKVTYNVNSFIDKNNDLLFRDLSQAMWKARH-PLLRSLFPEg------------------ 550  cattle
Q01989  567 ah---rtlRDEEGFLVRHFAGAVCYNTEQFIEKNNDALHASLEGLVQECDN-PLLQTLFPSgs----------------- 625  fruit fly
2DFS_M  543 --------LSNKAFIIKHFADKVEYQCEGFLEKNKDTVYEEQIKVLKSSKKfKLLPELFQDeekaisptsatpsg-rvpl 613  chicken
P32492  557 --------FGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTN-PIFKQILDNrelrsddap---------- 617  Saccharomyces cerev...
P08964  575 ----------KNGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQN-DIISKLFQPegeksssag---------- 633  Saccharomyces cerev...
P12844  574 k-----gkQGDAHFAIVHYAGTVRYNATNFLEKNKDPLNDTAVALLKHSTDnSLMLDIWQDyqtqeeaae---------- 638  Caenorhabditis elegans
1LKX_A  550 ----------TRPEDSKKRP-ETAGSQFRNAMNALITTLLACSPHYVRCIKSNDNKQAGVIDEDRVRHQVRYLGLLENVR 618  Dictyostelium disco...
P22467  564 kngfannaakTFIPTDKKRP-ITAGFQFKNQVTSLLKSLYSCSPHYVRCIKPNSNMRALEWDQSKCAEQVAYLGLFENLL 642  Dictyostelium disco...
P34092  546 -----------tGSLQKKRP-TTAGFKIKTSAGELMKALSQCTPHYIRCIKPNETKKAKDWENSRVKHQVQYLGLLENVR 613  Dictyostelium disco...
P19524  620 kleleqagskKPGPIRTVNRkPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIR 699  Saccharomyces cerev...
P10568  551 ----------DPKQASLKRP-PTAGAQFKSSVTTLMKNLYSKNPNYIRCIKPNEHQQRGHFSFELVSVQAQYLGLLENVR 619  cattle
Q01989  626 ---------sTSVRGKL-NF-ISVGSKFKTQLGELMEKLEQNGTNFIRCIKPNSKMIDRQFEGSLALAQLKCSGTISVLE 694  fruit fly
2DFS_M  614 srtpvkpakaRPGQTSKEHK-KTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIR 692  chicken
P32492  618 -eeqntekkiMIPARLSQKK-PTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIR 695  Saccharomyces cerev...
P08964  634 -veanisnqeVKKSARTSTF-KTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIR 711  Saccharomyces cerev...
P12844  639 --aakagqtaGGKRGKSSSF-ATVSMIYRESLNNLMNMLYQTHPHFIRCIIPNEKKASGVIDSALVLNQLTCNGVLEGIR 715  Caenorhabditis elegans
1LKX_A  619 VRRAGFAGRIEYTRFYNRYKMLCKKTW--------PSFNGTAKQATELILQQH----NID---KEEIRMGKTKVFIR 680  Dictyostelium discoideum
P22467  643 VRRAGYCYRQTFSKFMRRYYMIGKSTW--------PKWSGDAEKGVNLLMGEL----TQEiniKEEVQYGKTKIFIR 707  Dictyostelium discoideum
P34092  614 VRRAGFAYRNTFDKVLKRYKKLSSKTWgi-----wGEWKGDAIEGCKTIFQDM----NLE---AGQWQLGKTKVFIR 678  Dictyostelium discoideum
P19524  700 ISCAGFPSRWTFEEFVLRYYILIPHEQwdlifkkkETTEEDIISVVKMILDAT----VKD---KSKYQIGNTKIFFK 769  Saccharomyces cerevisi...
P10568  620 VRRAGYAYRQAYGSFLERYRLLSRSTW--------PRWNGGDQEGVEKVLGEL----SMS---SEELAFGKTKIFIR 681  cattle
Q01989  695 LMEHGYPSRVLFADLYSMYKSVLPPELvs----------lPARTFCEAMFQSL----NLS---AKDFKFGITKVFFR 754  fruit fly
2DFS_M  693 ISAAGFPSRWTYQEFFSRYRVLMKQKd----------vLSDRKQTCKNVLEKL----ILD---KDKYQFGKTKIFFR 752  chicken
P32492  696 ISCAGFPSRWTFDEFVQRYFLLTDYSLwsgilynpDLPKEAIVNFCQSILDAT----ISD---SAKYQIGNTKIFFK 765  Saccharomyces cerevisi...
P08964  712 LAREGYPNRIAFQEFFQRYRILYPENSttt--tfsSKLKASTKQNCEFLLTSL----QLD---TKVYKIGNTKLFFK 779  Saccharomyces cerevisi...
P12844  716 ICRKGFPNRMLYPDFKHRYAILAADAAke----------sDPKKASVGILDKIsvdgNLT---DEEFKVGETKIFFK 779  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap