1CI6


Conserved Protein Domain Family
bZIP_1

?
pfam00170: bZIP_1 
Click on image for an interactive view with Cn3D
bZIP transcription factor
The Pfam entry includes the basic region and the leucine zipper region.
Statistics
?
PSSM-Id: 395118
Aligned: 15 rows
Threshold Bit Score: 44.294
Threshold Setting Gi: 12084726
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CI6_A         2 KKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIE 61  human
P42776       261 KRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMALRSELNQLNEKSDKLRGANA 320 thale cress
P42775       251 KREKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMSLRSKLGQLNNESEKLRLENE 310 thale cress
XP_004229974 279 KREKRKQSNRESARRSRLRKQAEAEELAIRVQALTGENLTLRSEINKLMENSEKLKLDNa 338 tomato
P42777       189 QRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQLLKEIEESTKERYKKLMEVL 248 thale cress
P39970       386 KRARLLERNRIAASKCRQRKKMSQLQLQREFDQISKENTMMKKKIENYEKLVQKMKKISR 445 Saccharomyces cerevisiae S288C
P29747       443 KKIRRKIKNKISAQESRRKKKEYMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLH 502 fruit fly
P17275       270 KVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSTAGLLREQVAQLKQKVM 329 human
P18289       214 KLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLASIVKNLKDHVAQLKQQVM 273 fruit fly
Q03060       288 KRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICS----PKT 343 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap