1ALA,1AVC,1W45,1AII,4X9P,2Q4C,4MDU,4X9P,1W45,1AVC,1AVC,1AII,1AOW,1AVC,1AOW,2Q4C,1AII,1W45,4X9P,4X9P,1AII,1AOW,1AVC,1AVC


Conserved Protein Domain Family
Annexin

?
pfam00191: Annexin 
Click on image for an interactive view with Cn3D
Annexin
This family of annexins also includes giardin that has been shown to function as an annexin.
Statistics
?
PSSM-Id: 395139
Aligned: 100 rows
Threshold Bit Score: 52.4755
Threshold Setting Gi: 159108073
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ALA_A    91 FDAH-ALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYE-ANLEDKITGETSGHFQRLLVVL 156 chicken
P91144   101 YDAQcVYKSLSNRHG-DRSVAIEIACTRSPRQMRALRDTYQIDYR-KSLDKDLTVKVEGVVGKMMHLL 166 Caenorhabditis elegans
O81536    87 RDAY-LAKEATKRWTKSNFVLVEIACTRSPKELVLAREAYHARNK-KSLEEDVAYHTTGDHRKLLVPL 152 tomato
O76027   201 QDVQ-ALQRAEGP--SREETWVPVFTQRNPEHLIRVFDQYQRSTG-QELEEAVQNRFHGDAQVALLGL 264 human
P20073   344 EDAQrLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMAN-RDLLSSVSREFSGYVESGLKTI 410 human
Q29471   173 QDAKdLYDAGDGRWGTDELAFNEVLAKRSHKQLRATFQAYQILID-KDIEEAIEAETSGDLQKAYLTL 239 dog
1AOW_A   163 QDAQdLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQ-KDIEQSIKSETSGSFEDALLAI 229 cattle
O93444   175 KDAKdIFEAGEARWGTDEVKFLTVLCVRNRNHLLRVFDEYKKISK-RDIEDSIKREMSGSLEDVFLAI 241 Japanese medaka
P24639   319 KDAEdLYKAGEGKIGTDEKEFIKILTSRSLPHIAAVASEYIKHHKkHSLIKAIDSEFSGSIKTGLIAI 386 Dictyostelium discoideum
EGZ73500 324 rDVDdLYNATEGKIGTDEMRVCSILSLRNDNQIRAISYEYRQKYA-RDLDTVIQKEFSGHMKDALLiq 390 Neurospora tetrasperma FGSC 2509
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap