2W49


Conserved Protein Domain Family
Tropomyosin

?
pfam00261: Tropomyosin 
Tropomyosin
Tropomyosin is an alpha-helical protein that forms a coiled-coil structure of 2 parallel helices containing 2 sets of 7 alternating actin binding sites. The protein is best known for its role in regulating the interaction between actin and myosin in muscle contraction, but is also involved in the organisation and dynamics of the cytoskeleton in non-muscle cells. There are multiple cell-specific isoforms, expressed by alternative promoters and alternative RNA processing of at least four genes. Muscle isoforms of tropomyosin are characterized by having 284 amino acid residues and a highly conserved N-terminal region, whereas non-muscle forms are generally smaller and are heterogeneous in their N-terminal region.
Statistics
?
PSSM-Id: 395200
Aligned: 18 rows
Threshold Bit Score: 154.416
Threshold Setting Gi: 156222000
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2W49_A        42 KLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADES-ERGM 120
Q6S5G5         7 KMATLRQTLEDAEARAAKAEDELKNANDRADSAETEVAALTKQLQQLEDDLDAAESKLADTQGQLTEAEKQADES-ERAR 85  starlet sea ane...
EDO38704      13 KLQAIKEKIDETEDRELAAMEKLREAEERFEKAEGEAESFKRRIQLIEAESRRVKELSQKKDHELEEMHKRSKEE-ENLC 91  starlet sea ane...
EDO42849      10 KMQQIKDQTDDAEERELGAKSLLKEAEAKEEQLLSEASGIQRRITLLNSELEKTNERVEE-QEKLLQNLVHNSEMnEEAR 88  starlet sea ane...
XP_003372651  49 KMMQVENELDKAQEELTGANAQLEEKEKKVQEAEAEVAALNRRIQLLEEDFERAEERLKIATEKLEEASQTADES-ERVR 127 Trichinella spi...
P06754       103 KMRQTKEEMEKYKDECEEFHKRLQLEVVRREEAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADES-ERAR 181 fruit fly
Q17H78        18 KMRQTKEEMEKYKDECEEFHKKLQGEVMRREEAESEVAALNRRIQLLEEDLERSEERLASATAKLSEASAAADES-ERIR 96  yellow fever mo...
Q6NN28        49 KIQTVENELDQTQEALTLVTGKLEEKNKALQNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADES-ERIR 127 fruit fly
Q60UW4        21 KMRQAREEAEAAKDEADEVKRQLEEERKKREDAEAEVAALNRRIVLVEEDLERTEDRLKVATSKLEQATKAADEA-DRAR 99  Caenorhabditis ...
CCD81110      49 KIQQVDTDKETAQTQLAETNTKLEETDKRATEAEAEVASLQKRIRQLEDELESTETRLQEATVKLEEASKAADES-DRGR 127 Schistosoma man...
2W49_A       121 KVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSL 200
Q6S5G5        86 KVLENRGASDEERLASLERQYNDALERTEEAEKQYEEISERLQELENELEEAEQKADAAEARVKELEEEVTLVGNNLRSL 165 starlet sea ane...
EDO38704      92 KTLEVTDRESDEKMRELEDALEEAIELDKSTADKLAEVELKIKVVQGELEKAVERGDRAEMMCEHLMNDFTGTSEVLRDL 171 starlet sea ane...
EDO42849      89 KGLEESEMKGDEKIMDLEAKLKEMERVEKETLETLTEAERKEVVVTRDLERAIEKGRTLENRIQSLESTMGNALTNIQKL 168 starlet sea ane...
XP_003372651 128 KVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSL 207 Trichinella spi...
P06754       182 KILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSL 261 fruit fly
Q17H78        97 KALENRTNMEDDRVAILEAQLSQAKLIAEEADKKYEEVARKLVLMEQDLERSEEKVEMNESKIVELEEELRVVGNNLKSL 176 yellow fever mo...
Q6NN28       128 KALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLVLMEQDLERSEEKVELSESKIVELEEELRVVGNNLKSL 207 fruit fly
Q60UW4       100 KSMETRSQQDEERANFLETQVDEAKVIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSL 179 Caenorhabditis ...
CCD81110     128 KVLENRTFADEERINQLEEQLKESTFMAEDADRKYDEATRKLAVAEVALSHAEDRIEAAESKITELEEELRIVGNNVKSL 207 Schistosoma man...
2W49_A       201 EAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMT 275
Q6S5G5       166 EISEGKASEREDTYENQIRELETKLQDAEERAEKAEQKVQELEAQAEAMEAELEKAKEQYEKVKEELDSTLAELS 240 starlet sea anemone
EDO38704     172 EVKDAAASEREIDNEDKIEFIQENLKQMVYRYEEAERKAPPLEMLLDQLVEDLELYRLKRKQVDEEM-KAMGELV 245 starlet sea anemone
EDO42849     169 EASGDEAYEREELKEEKLKFFQEQLKQYEQRYEDAEREALKLERINDTIIIEIDSYKKKKEEILREMDLELVDLN 243 starlet sea anemone
XP_003372651 208 EVSEEKALQREDSYEEQIRLLTQRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKEKYKAISEELDQTFQELS 282 Trichinella spiralis
P06754       262 EVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVELI 336 fruit fly
Q17H78       177 EVSEEKAMASRDSVEDKIHQLNDKLTNAEARAEFAERSVQKLQKEVDRLEEEVTKEKSKYKAIAAELDLTFADLS 251 yellow fever mosquito
Q6NN28       208 EVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVELI 282 fruit fly
Q60UW4       180 EVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELLLEKERVRNLTEEIEQTVQEIQ 254 Caenorhabditis briggsae
CCD81110     208 EISEQEAAQREEAYEENIRDLTERLKAAEDRAQESERLVNTLQADADRLEDELVTEKEKYKALSEELDSTFAELT 282 Schistosoma mansoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap