1DFN,1ZMM


Conserved Protein Domain Family
Defensin_1

?
pfam00323: Defensin_1 
Mammalian defensin
Statistics
?
PSSM-Id: 395255
View PSSM: pfam00323
Aligned: 41 rows
Threshold Bit Score: 29.5003
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DFN_A        2 CYCRIP-ACIAGERRYGTCIYQGRLWAFCC 30 
P07469       62 CACRRR-FCPNSERFSGYCRVNGARYVRCC 90  rabbit
P07468        3 CVCRKQlLCSYRERRIGDCKIRGVRFPFCC 32  rabbit
P11478       65 CICTTR-TCRFPYRRLGTCIFQNRVYTFCC 93  domestic guinea pig
4_pfamImport  1 CSCRRA-FCDLGERHIGTCFLRDNLYAFCC 29 
1_pfamImport  1 CVCRRY-LCESGELFAGYCTKSGIRLSLCC 29 
XP_003411905 65 CYCRSV-RCRISERVSGFCKTKGIAYLFCC 93  African savanna elephant
XP_003411906 65 CHCRRL-LCLSSEHLSGICTIKGVRYPFCC 93  African savanna elephant
ELV14234     65 CRCTRG-FCLFPERNSGFCLLRGIRYSFCC 93  Chinese tree shrew
ELV11873     69 CRCFPG-SCLFPERSTGFCLIRGIRYSFCC 97  Chinese tree shrew
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap