5U1D,4M1M,4F4C,4F4C,6FN1,4M1M,4MYH,6PZI,6PZI


Conserved Protein Domain Family
ABC_membrane

?
pfam00664: ABC_membrane 
Click on image for an interactive view with Cn3D
ABC transporter transmembrane region
This family represents a unit of six transmembrane helices. Many members of the ABC transporter family (pfam00005) have two such regions.
Statistics
?
PSSM-Id: 395537
View PSSM: pfam00664
Aligned: 70 rows
Threshold Bit Score: 129.686
Threshold Setting Gi: 1170904
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5U1D_A  187 LSLFLVLVVLSSLGEMAIPFFTGRLTDWILQD----GSADT--------------------------FTRNLTLMSILTI 236  human
P54719   49 LILVMLMVVISAIFGLLGPFVIGKAIDHFIVG----KTVSG--------------------------LIPVLLLLLAIYI 98   Bacillus subtilis s...
P45861   16 FFLDFFSAIAGGLMELSFPLIVNYFIDTLLPG----RDWGL--------------------------IIATSIGLFAVYA 65   Bacillus subtilis s...
P47260   16 LILAPFFTFAQIVIDLIIPSFLASAISVVFSI----DKLKQdesggktisvdfigganinfanvreaQIVLATTVILLAL 91   Mycoplasma genitali...
P9WQJ1   17 VAMLMMLQLVSTLASLYLPTVNAAIVDDGVAK----GDTAT--------------------------IVRLGAVMLGVTG 66   Mycobacterium tuber...
P60752   27 LIVAGVALILNAASDTFMLSLLKPLLDDGFGK----TDRSV--------------------------LVWMPLVVIGLMI 76   Escherichia coli K-12
P9WQJ3   53 TIGVIVPRILGHATDLLFNGVIGRGLPGGITKaqavASARArgdntfadllsgm-nvvpgqgvdfaaVERTLALALALYL 131  Mycobacterium tuber...
P39109  287 MLLAAFFKAIHDVLAFTQPQLLRILIKFVTDYnserQDDHSslqgfenn-----------hpqklpiVRGFLIAFAMFLV 355  Saccharomyces cerev...
P21441  231 VWAQILPKLLSDVTALMLPVLLEYFVKYLNADn---ATWGW--------------------------GLGLALTIFLTNV 281  Leishmania tarentolae
P53049  207 YFMSIVFAILANCTSGFNPMITKRLIEFVEEK----AIFHSm------------------------hVNKGIGYAIGACL 258  Saccharomyces cerev...
5U1D_A  237 ASAVLEFVGDGIY--NN-TMGHVHSHLQGEVFGAVLRQETEFFQQ--NQTGNIMSRVTEDTSTLSDSLSENLSLFLWYLV 311  human
P54719   99 IQSLSLWFQNYWM--IT-ISQGTVFRMRSELFTHLHELPIPFFDK--QRHGELMSRVTNDIENVSSTLNTSVIQILSSVI 173  Bacillus subtilis s...
P45861   66 LSSALQYIVTYWG--HM-LGINIETDMRKSLFDHLQKLSFKFYDN--NKTGTLMSKLTNDLMYIGEVAHHGPEDLFIAVM 140  Bacillus subtilis s...
P47260   92 CGLFFGLISIYCA--SY-VSANTSFLLRKKIFAKLMRITTPSHDH--YGSSTLLVRLTNDVYLMEVIAFDFLRLIIRAPL 166  Mycoplasma genitali...
P9WQJ1   67 LQVLCAIGAVYLG--SR-TGAGFGRDLRSAMFEHIITFSERETAR--FGAPTLLTRSTNDVRQILFLVQMTATVLVTAPI 141  Mycobacterium tuber...
P60752   77 LRGITSYVSSYCI--SW-VSGKVVMTMRRRLFGHMMGMPVSFFDK--QSTGTLLSRITYDSEQVASSSSGALITVVREGA 151  Escherichia coli K-12
P9WQJ3  132 AAALMIWAQARLL--NL-TVQKTMVRLRTDVEDKVHRLPLSYFDG--QQRGELLSRVTNDIDNLQSSLSMTISQLVTSIL 206  Mycobacterium tuber...
P39109  356 GFTQTSVLHQYFLnvFN-TGMYIKSALTALIYQKSLVLSNEASGL--SSTGDIVNLMSVDVQKLQDLTQWLNLIWSGPFQ 432  Saccharomyces cerev...
P21441  282 IQSCSAHKYDHIS--IR-TAALFETSSMALLFEKCFTVSRRSLQRpdMSVGRIMNMVGNDVDNIGSLNWYVMYFWSAPLQ 358  Leishmania tarentolae
P53049  259 MMFVNGLTFNHFFhtSQlTGVQAKSILTKAAMKKMFNA--SNYARhcFPNGKVTSFVTTDLARIEFALSFQPFLAGFPAI 336  Saccharomyces cerev...
5U1D_A  312 RGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQLLEVQVRESLAKSSQVAIEALSAMPTVRSFANEEGEAQKFR 391  human
P54719  174 TFVGTIAVMLYMSPLLTLITLTIIPVMAASLKWITNRTGKLFKEQQKNLGDLNGYIEESVSGAKVIKAYSREKQITAEFL 253  Bacillus subtilis s...
P45861  141 TILGAFGVMLFINWQLALLTFIIMPIVIWLALYFNKKMTKAFTTLNKDIGDFSARVENNIGGIRLVQAFGNEAFEKERFA 220  Bacillus subtilis s...
P47260  167 LFIGGLVFAVTTNQDMSISLLITFPLILLVIGILNRKSIPLFKENQKSVDKINERVEEDVSGYKVIQSFNLHSFTNNKFK 246  Mycoplasma genitali...
P9WQJ1  142 MCVGGIIMAIHQEAALTWLLLVSVPILAVANYWIISHMLPLFRRMQSLIDGINRVMRDQLSGVRVVRAFTREGYERDKFA 221  Mycobacterium tuber...
P60752  152 SIIGLFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFD 231  Escherichia coli K-12
P9WQJ3  207 TMVAVLAMMVSISGLLALITLLTVPLSLLVTRAITRRSQPLFVAHWTSTGRLNAHLEETYSGFTVVKTFGHQAAARERFH 286  Mycobacterium tuber...
P39109  433 IIICLYSLYKLLGNSM-WVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLE 511  Saccharomyces cerev...
P21441  359 LVLCLLLLIRLVGW-LRVPGMAVLFVTLPLQAVISKHVQDVSERMASVVDLRIKRTNELLSGVRIVKFMGWEPVFLARIQ 437  Leishmania tarentolae
P53049  337 LAICIVLLIVNLGP-IALVGIGIFFGGFFISLFAFKLILGFRIAANIFTDARVTMMREVLNNIKMIKYYTWEDAYEKNIQ 415  Saccharomyces cerev...
5U1D_A  392 EKLQEIKTLNQKEAVAYAVNSWTTSISGMLLKVGILYIGGQLVTS-G-AVSSGNLVTFVLYQMQFTQAV 458  human
P54719  254 EKNAALKTSGFWAQTISGFIPKVMNSLNNLSFTMIAAIGGLFALK-G-WISIGSIVVFAEYSRQFTRPL 320  Bacillus subtilis subsp. subti...
P45861  221 VNNQRFRVTKLSSYKIMAKNGSISYMLTRFVTLFVLLCGTWFVIR-G-SLSYGEFVAFVLLTNVLFRPI 287  Bacillus subtilis subsp. subti...
P47260  247 IANEGWKKNSTSSLFINSLNIPFTFFLSSLTIIIALLLVFQLDSSvSvDPLPQDAAIRPNIFAFFQYNF 315  Mycoplasma genitalium G37
P9WQJ1  222 QANTALSNAALSAGNWQALMLPVTTLTINASSVALIWFGGLRIDS-G-QMQVGSLIAFLSYFAQILMAV 288  Mycobacterium tuberculosis H37Rv
P60752  232 KVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVM-D-SLTAGTITVVFSSMIALMRPL 298  Escherichia coli K-12
P9WQJ3  287 ELNDDVYQAGFGAQFLSGLVQPATAFIGNLGYVAVAVAGGLQVAT-G-QITLGSIQAFIQYIRQFNMPL 353  Mycobacterium tuberculosis H37Rv
P39109  512 EVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTFAVFVYTED-R-ALTTDLVFPALTLFNLLSFPL 578  Saccharomyces cerevisiae S288C
P21441  438 DARSRELRCLRDVHVANVFFMFVNDATPTLVIAVV-FILYHVSGK---VLKPEVVFPTIALLNTMRVSF 502  Leishmania tarentolae
P53049  416 DIRTKEISKVRKMQLSRNFLIAMAMSLPSIASLVT-FLAMYKVNK-G-GRQPGNIFASLSLFQVLSLQM 481  Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap