Conserved Protein Domain Family
Orbi_VP5

?
pfam00901: Orbi_VP5 
Orbivirus outer capsid protein VP5
cryoelectron microscopy indicates that VP5 is a trimer implying that there are 360 copies of VP5 per virion.
Statistics
?
PSSM-Id: 279272
View PSSM: pfam00901
Aligned: 2 rows
Threshold Bit Score: 1057.8
Threshold Setting Gi: 139275
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P07389   7 SLSRFGKKVGNALTSNTAKKIYSTIGKAAERFAESEIGAATIDGLVQGSVHSIITGESYGESVKQAVLLNVLGTGEELPD 86  Bluetongue virus (ser...
P07389   7 SLSRFGKKVGNALTSNTAKKIYSTIGKAAERFAESEIGAATIDGLVQGSVHSIITGESYGESVKQAVLLNVLGTGEELPD 86  Bluetongue virus (ser...
P07389  87 PLSPGERGMQTKIKELEDEQRNELVRLKYNKEITEKFGKELGEVYDFMNGEAKEVEAVEEQYTMLCKAVDSYEKILKEED 166 Bluetongue virus (ser...
P07389  87 PLSPGERGMQTKIKELEDEQRNELVRLKYNKEITEKFGKELGEVYDFMNGEAKEVEAVEEQYTMLCKAVDSYEKILKEED 166 Bluetongue virus (ser...
P07389 167 SKMAILARALQREAAERSEDEIKMVKEYRQKIDALKSAIEIERDGMQEEAIQEIAGMTADVLEAASEEVPLIGAGMATAV 246 Bluetongue virus (ser...
P07389 167 SKMAILARALQREAAERSEDEIKMVKEYRQKIDALKSAIEIERDGMQEEAIQEIAGMTADVLEAASEEVPLIGAGMATAV 246 Bluetongue virus (ser...
P07389 247 ATGRAIEGAYKLKKVINALSGIDLSHMRSPKIEPTIIATTLEHRFKDIPDEQLAISVLNKKTAVADNCNEIAHIKQEILP 326 Bluetongue virus (ser...
P07389 247 ATGRAIEGAYKLKKVINALSGIDLSHMRSPKIEPTIIATTLEHRFKDIPDEQLAISVLNKKTAVADNCNEIAHIKQEILP 326 Bluetongue virus (ser...
P07389 327 KFKQIMNEEKEIEGIEDKVIHPRVMMRFKIPRTQQPQIHIYAAPWDSDDVFFFHCVSYHHRNESFFLGFDLGIDVVHFED 406 Bluetongue virus (ser...
P07389 327 KFKQIMNEEKEIEGIEDKVIHPRVMMRFKIPRTQQPQIHIYAAPWDSDDVFFFHCVSYHHRNESFFLGFDLGIDVVHFED 406 Bluetongue virus (ser...
P07389 407 LTSHWHALGMAQEASGRTLTEAYREFLNLSISSTFSSAIHARRMIRSRAVHPIFLGSMHYDITYEALKNNAQRIVYDDEL 486 Bluetongue virus (ser...
P07389 407 LTSHWHALGMAQEASGRTLTEAYREFLNLSISSTFSSAIHARRMIRSRAVHPIFLGSMHYDITYEALKNNAQRIVYDDEL 486 Bluetongue virus (ser...
P07389 487 QMHILRGPLHFQRRAILGALKFGVKIL 513 Bluetongue virus (serotype 10 / American isolate)
P07389 487 QMHILRGPLHFQRRAILGALKFGVKIL 513 Bluetongue virus (serotype 10 / American isolate)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap