Conserved Protein Domain Family
Clusterin

?
pfam01093: Clusterin 
Clusterin
Statistics
?
PSSM-Id: 395869
Aligned: 49 rows
Threshold Bit Score: 480.914
Threshold Setting Gi: 0
Created: 22-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008272128  84 ELQEMSTQGSKYIDREIQNAVKGVQ-EIKTLIEKTNEERKTLLSVLEEAKKNKEDALNETRDSETKLKAFPEVCNETMMA 162 rabbit
NP_001268722  29 ELQEMSNQGSKYINKEIQNAVKGVK-EIKNLIEKTNEERKTLLTTLEKAKKKKEDALEETKDSELKLKALPQVCNETMMA 107 domestic guinea...
XP_012663173  30 ELQEMSTQGSKYVNKEIQNALNGVK-EIKTLIEKTNEERKLLLNTLEEAKKKKEDALNETRDSEMKLKESSGVCNETMLA 108 small-eared galago
P10909        30 ELQEMSNQGSKYVNKEIQNAVNGVK-QIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMA 108 human
XP_002914459  29 ELQEMSTEGSKYINKEIKNALKGVK-QIKTLIEQTNEERKSLLSNLEEAKKKKEDALNETKDSETKLKASQGVCNDTMMA 107 giant panda
XP_023611854  29 ELQEMSTEGSKYVNKEIKNAFKEVK-HIKSLIDNTNDERKSLLISLEEAKKKKEDALTDTKDTEMKLKASQEVCNDTMLS 107 little brown bat
ELK17486      29 ELQEMSTEGSKYVNKEIKNALKEVK-QIKTLIEHTNDERKSLLSSLEEAKKQKEDALTDTKETEMKLKASQGVCNESMMA 107 black flying fox
Q29549        30 ELQEMSTEGSKYVNKEIKNALKEVK-QIKTLIEQSNEERKSLLSSLEEAKKKKEDALNDTRDTETKLKGSQGLCNETMMA 108 pig
XP_017908265  55 rlveTSTEGSKYVNKEIKNALKEVKxK--TDIEQTNEERKLLHSSLEEAKKKKADALNDTRDSETKLKASQEVCNETMMA 132 goat
XP_010590652   1 -----------------------MK-EIKTLMGQTDEERQTLLSTLEKAKKQKEDAVKVTRDTEMKLKASPEVCNDTMTA 56  African savanna...
XP_008272128 163 LWEECKPCLKQTCMKFYArVCRSGSGLVGRQLEEFLNQSSPFYFWINGDRIDSLLENDRQQSHVLDVMQDSFNRATGIMD 242 rabbit
NP_001268722 108 LWEECKPCLKQTCMKFYArVCRSGSGLVGRQLEEFLNQSSPAYFWMNGDRIDSLLESDRQQTHVLDAMQDSFNRVSGIMD 187 domestic guinea...
XP_012663173 109 LWEECKPCLKQTCMKFYArVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRVDSLLEDDRQQSHMLDIMQDHFSQASSIMD 188 small-eared galago
P10909       109 LWEECKPCLKQTCMKFYArVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIID 188 human
XP_002914459 108 LWEECKPCLKQTCMKFYArVCRSGSGLVGHQLEEFLNQSSPFYFWINGDRIDSLLENDRQQTHALDVMQDSFNRVSSIMD 187 giant panda
XP_023611854 108 LWEECKPCLKQTCMKFYArVCRSSSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHVLDTMEDRFEKMSSIMD 187 little brown bat
ELK17486     108 LWEECKPCLKQTCMKFYArVCRSGSGLVGRQLEEFLNQSSPFYLWTNGDRIDSLLENDRQQTHVLDAMEDRFKRVSSIMD 187 black flying fox
Q29549       109 LWEECKPCLKQTCMKFYArVCRSGSGLVGHQLEEFLNQSSPFYFWINGDRIDSLMENDRQQSHVMDIMEDSFNRASNIMD 188 pig
XP_017908265 133 LWDECKPCLQQTCVKFYApVCSSSSGLVGHRLEDFLNQSSPFYFWINGDRIHSLMENDRQQSHVMDVMEDSFNWASNTMD 212 goat
XP_010590652  57 LWEECKPCLKHTCVKFYTrVCRSGSPAVGHQLDEFLNQTSPFYIWIDGDRVDTLLENNQEQTHMLDAMEDRFSQVSRAMD 136 African savanna...
XP_008272128 243 ELFQDRFFTHKPQDTFYHSPFSY-----FRRPPLHYAKSRLVRNImplslygplNFQ-DMFQPFFEMIHQAQQAMDVHLH 316 rabbit
NP_001268722 188 TLFQDRFFTQEPQDTHYFSRFGLl----LRWPHFLYPKSRLVRSIlplspfgslGFHdDMFQPFFEMIHQAQEAMEPHFH 263 domestic guinea...
XP_012663173 189 ELFRDSFFTHEPQDTYHYQPINLl----HRRPHLLFPKSRFARTIlpytpfeplNFQ-DMFQPFFDMIHQAQQAMDAPFQ 263 small-eared galago
P10909       189 ELFQDRFFTREPQDTYHYLPFSLp----HRRPHFFFPKSRIVRSLmpfspyeplNFH-AMFQPFLEMIHEAQQAMDIHFH 263 human
XP_002914459 188 ELFQDRFFTREPQDPFHYSPFSSf----QRRPFFFNPKSRFVRNImpfpgyqplNFH-DIFQPFFDMIHQAQQAMDVNLH 262 giant panda
XP_023611854 188 ELFHNSFFNREALDPYHFPPFGSs----PRRPLFFTPKTRFARNLmpfpmfgipNFQ-DMFRPLFDMMHQAQQTMDSQLQ 262 little brown bat
ELK17486     188 ELFQDRFFTREPLDT-YFSSFGSs----PRRSLYFSPKSRLARNImpfpmfrppHFQ-DMFQPFFDMISQAQQAMDGHPH 261 black flying fox
Q29549       189 ELFQDRFFNREPFDTQFFSPFGSs----HRGSLFFNPKSRFARNImpfplftdlNYH-DMFQPFFDMIHQAQQAMDAHLH 263 pig
XP_017908265 213 ELFQDRFFPQRPQDTQYYSPFSSf----PRGSLFFNPKSRFAWNLpfpv-leplNFH-DVFQPFYNMIHQAQQAMDAHLH 286 goat
XP_010590652 137 KIFQSRFFRMEPLKPFFHSPFSSfrdssFHKPYFFYPKSRVVRNTvpfffheplNFL-DLFRPFSDLIQQAQQAMDISRQ 215 African savanna...
XP_008272128 317 SPayqtPNVEFITGGPDD-RAVCKEIRHNSTGCLRMKDQCAKCQEILSVDCsannPSQNQLRQELNDSLRLAEELTKRYN 395 rabbit
NP_001268722 264 RPafqpLGKDFTKEVPDN-RTVCKEIRRNSTGCLRMKDQCEKCREILSVDCsannPAQAKLRQELNDSLQVAELLTQKYN 342 domestic guinea...
XP_012663173 264 GSafhqPQMDSIREGNEDkRLVCREIRHNSTGCLKMKNQCEKCKEILSVDCsansPSQAQLRQELNDSLQIAEKLTQKYN 343 small-eared galago
P10909       264 SPafqhPPTEFIREGDDD-RTVCREIRHNSTGCLRMKDQCDKCREILSVDCstnnPSQAKLRRELDESLQVAERLTRKYN 342 human
XP_002914459 263 RLph-fP-MEFTEEGNQD-GAVCKEIRHNSTGCLKMKDQCEKCREILSVDCssnnPAQVQLRQELNNSLQIAEKFTRLYD 339 giant panda
XP_023611854 263 EPlfefPMLEFPEESNDN-RTICKEIRHNSTGCLKMKDQCAKCQEILSVDCsgsnPSQNLLREELNSSLELAEKLARQYD 341 little brown bat
ELK17486     262 RLpyefPMAEFTADHDN--RSVCKEIRHNSTGCLRMKDQCEKCQEILSVDCsasdPSQNQLRQELNSSLQLAEKFSKLYD 339 black flying fox
Q29549       264 RIpyhfPEAGVPENSND--RAVCKEIRHNSTGCLRMKDQCEKCREILSVDCsasnSSQMQLRQELYTSLQMAEKFSKLYD 341 pig
XP_017908265 287 RTpyhfPMVEFAGENND--RTVCKEISSNSTRCLSMEGQCVKCQEILEVDCsaniPTQTLLRQQLNESLQLVEKFSRLCD 364 goat
XP_010590652 216 PLigefAT-----GNSNDtRLVCREMRRNSTGCLKMKDQCEKCQEILSVDCsasnPAQAQLRQELKTALQIAEKFTKQYD 290 African savanna...
XP_008272128 396 ELLQSYQWKMLNTSSLLDQLNEQFNWVSQLANLT--QGPDQYYlRVSTV-TSHTSESEaPs--RVTEVVVKLFDSDPITI 470 rabbit
NP_001268722 343 ELLQSYQRKMFSTSSLLNQLNDQFSWVSRLANLT--QGDDQAYlHVSTV-STHNSDSD-Tp-sGATEVVVKLFDSDPITV 417 domestic guinea...
XP_012663173 344 ELLQTYQWTMLNTSALLEQLNDQFSWVSRLANLTqaQGQDQYYlRVTTV-TSHPSNSDpSs--GVTDVVVKLFDSNPITV 420 small-eared galago
P10909       343 ELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLT--QGEDQYYlRVTTV-ASHTSDSDvPs--GVTEVVVKLFDSDPITV 417 human
XP_002914459 340 ELLQSYQEKMFNTSSLLKQLNEQFSWVSQLANLT--QSEDPFYlQVTTV-GSQTSDSGvPs--GVTKVVVKLFDSDPITV 414 giant panda
XP_023611854 342 ELLRSYQQKMLNTSALLKQLNEQFNWVSQLANLT--QREDRYSlHVTTV-ASRGSDSSvPs--GFTKVILTLFDSDPITV 416 little brown bat
ELK17486     340 DLLQSYQQKMLNTSFLLKQLNEQFNWVSQLANLT--QREELYPlQVTTV-ASHSSDSSvPt--GFTRVVLKLFDSYPIMV 414 black flying fox
Q29549       342 QLLQSYQQKMLNTSSLLKQLNEQFSWVSQLANLT--QNDDRYYlQVTTV-NSHGSDPSvPs--GLTKVVVKLFDSYPITL 416 pig
XP_017908265 365 QLLQPYQQNMLDTSALLKQLIEQFTWVSQLAHLM--QNDDQYHlQVSTVmNPHSSDPRiPs--GLTKVVVKLFNPFPITV 440 goat
XP_010590652 291 ELLRSYQQKMFNTSSLLSQLNQQFSWVSQLANHT--QN-DEAYlQVFSV-TSKTPDLDkFskpGDTEVVVKLFDSDPMTV 366 African savanna...
XP_008272128 471 TIPEEVSRDNPKFMETVAEKALQEYRKK 498 rabbit
NP_001268722 418 IMPEEVSRDNPKFMDTVAEKALQEYRKK 445 domestic guinea pig
XP_012663173 421 SVPEEVVRNNPKFMDIVAEKALREYRKK 448 small-eared galago
P10909       418 TVPVEVSRKNPKFMETVAEKALQEYRKK 445 human
XP_002914459 415 MVPEVVSRNNPKFMETVAEKALQEYRQK 442 giant panda
XP_023611854 417 TVPEEVSMHDPKFMETVAEKALQEYRQS 444 little brown bat
ELK17486     415 TVP-EVSWDSPMFMETVAEKALQEYRQK 441 black flying fox
Q29549       417 IIPQEVS--DPKFMETVAEEALQQYRQR 442 pig
XP_017908265 441 MVLQEVS--SPNFMENVVEKALQQYChl 466 goat
XP_010590652 367 MVSKEVSWDRPKFMEIVAKKALDKFREK 394 African savanna elephant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap