1DIP


Conserved Protein Domain Family
TSC22

?
pfam01166: TSC22 
TSC-22/dip/bun family
Statistics
?
PSSM-Id: 395928
View PSSM: pfam01166
Aligned: 21 rows
Threshold Bit Score: 63.4729
Threshold Setting Gi: 675852626
Created: 22-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DIP_A                2 MDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQS 55  
XP_003106826         57 MDLVKTHLMFAVREEVDGLRSKIFDLENHVRRLEAENSILKRTIPNDTLKQLHL 110  Caenorhabditis remanei
Q22544               72 MDLVKTHLTFAVREEVETLRTTITDLEARLNALREENRLLRENVSPEVLAFITA 125  Caenorhabditis elegans
Q9U290              488 MELVKTHLTYAVREEVDTLRNTIAELEYQMRESQYECTYYRQNCAPDLIEQASS 541  Caenorhabditis elegans
XP_018667888        456 MDLVKKHLMLAVRDEVDELKDKIVELQDDNFKMKLENETLKGILTPEQFNIAQQ 509  vase tunicate
FlyBase:CG42281-PO   37 MDLVKSHLMIAVREEVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQL 90   fruit fly
XP_008184050        977 MDLVKSHLMYAVREEVEVLKEKIAELMDKVGLLETENSNLRMLVPPDMLEQYNR 1030 pea aphid
ESN91813            344 MDLVKSHLMFAVHEEVEQLKEQIKELMMRRSELEQENSILRASASPETLAKLNV 397  Helobdella robusta
EEB20409              1 MDLVKTHLMLTVREEVEVLKDKITELMDRISQLEVENTILKAHASQETLSQLSS 54   human body louse
EGT48249            436 MELVKTHLTYAVREEVDTLRNTIADLEYQMREFQYECNFYRQNCAPEVVEQASN 489  Caenorhabditis brenneri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap