Conserved Protein Domain Family
Citrus_P18

?
pfam05520: Citrus_P18 
Citrus tristeza virus P18 protein
Statistics
?
PSSM-Id: 114252
View PSSM: pfam05520
Aligned: 3 rows
Threshold Bit Score: 290.451
Threshold Setting Gi: 81924821
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9DTF7   1 MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSEDMLNSFSAISNCTIIADGSALLKDNTVVDRLESMN 80  Citrus tristeza virus
P87594   1 MSGSLGNSTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSEHMLNSFSAISNCTIIADGSALLKDNTVVDHLESMN 80  Citrus tristeza virus
Q66242   1 MSGSLGNSTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNEDMLNSFSAISNCTIIADGSALLKDNTVVDRLEGMN 80  Citrus tristeza virus
Q9DTF7  81 PLAYLLKLAKTTTTICFTMSNKVLFGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSIWFYNNGTFQNGLTRCNNL 160 Citrus tristeza virus
P87594  81 PLAYLLKLAKTTTTICFTMSNKVLFGTTKSEPLSCLAISADRVLFKVIIGTNVDDSRCGCSIWFYDNGMFQNGLTRCNNL 160 Citrus tristeza virus
Q66242  81 PLAYLLKLAKTTTTICFTMSNKVLFGTTKSEPLSCLAITSDRVLFKVVMGTNVDDSRCGCSIWFYNNGTFQNGLIRCNNL 160 Citrus tristeza virus
Q9DTF7 161 VALFSAT 167 Citrus tristeza virus
P87594 161 VALFSAT 167 Citrus tristeza virus
Q66242 161 VTLFSVT 167 Citrus tristeza virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap