3JB9,5GAM


Conserved Protein Domain Family
PRO8NT

?
pfam08082: PRO8NT 
Click on image for an interactive view with Cn3D
PRO8NT (NUC069), PrP8 N-terminal domain
The PRO8NT domain is found at the N-terminus of pre-mRNA splicing factors of PRO8 family. The NLS or nuclear localization signal for these spliceosome proteins begins at the start and runs for 60 residues. N-terminal to this domain is a highly variable proline-rich region.
Statistics
?
PSSM-Id: 311846
View PSSM: pfam08082
Aligned: 47 rows
Threshold Bit Score: 188.239
Threshold Setting Gi: 74621958
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
3JB9_A         79 KADLPPEHLRKIMKDRGDMSSRKFRADKRSYLGALKYLPHAVLKLLENMPMPWEEYREVKVLYHVTGAITFVNESPRVIE 158
gi 74604503    87 KADMPPEHLRKLIKDHGDMSSRKFASDKRAYLGALKFMPHGVIKLLENMPQPWEAVREVKVLYHISGAITFVNEIPRVVP 166
gi 122046973   53 KDDVPPEYLRKLMKDNGDLSGKSFGTERKLCVALLKYMPLALYKLLENMPMPWEETRYVNVVYHMGGVLTLVDDTPTVAE 132
gi 667836817   72 KADMPPEHLRKIVKDIGDVSQKKFSSDKRSYLGALKFMPHAVLKLLENMPMPWESAREVKVLYHVNGCLTLVNEIPRVIE 151
gi 255727639  104 KPEMPPQHLRKIMIDHGDLSSNKVASDKRSHLGSLKYLPHALLKLLENMPQPWEQQKEVKVLYHTTGAITFVNEIPRVIE 183
gi 927372991  121 KIEMPKEHLRKILNDQGDLSSKKFSQEKRSILGSLKYMPHAVLKLLENMPQPWEAVKEVRVIYHQSGAITFVDEIPRVIE 200
gi 123976938   38 akELPPGHIRQIMTSHGNMSHDKFAGQKRLYIGALKYAPHAVLKFLENMPMPWEELRKVRVLYHTAGALTFVNEVPRVVP 117
gi 501754129   72 KADLPPEHLRQIMRMHGDMSSKKYRHDKRSYLGALKYMPHAVLKLLENMPMPWEDVREVPVLYHITGAITFVNTVPRVIE 151
gi 149238566  201 pmEMPPQHLRKIISDHADMTLLKVTSDKRSHLGSLKYLPHALFKLLENIPHPWELSKEVKVLYHRTGAITFVDQSPRVIE 280
gi 398023633   63 KDLMPPEFIRKVVKDNGDLGGKRFKSERKLCVGMLPYIPLALLKLLENMPMPWEEARYVTVVYHVGGVLTIVDDTPTVAE 142
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
3JB9_A        159 PHFIAQWGTMWMMMRREK----RDRKNFKRLrFPPFDDEEPP-FSI-DQLLDLEPLEAIRM-DLDEEDDAPVMDWFYE 229
gi 74604503   167 QVYTAQWATMWVMMRREK----RDRRHFKRMrFPPFDDEEPP-ISWaENIQDVEPPEGILM-DLSPVDDSAVVDWFYE 238
gi 122046973  133 QLYLAQWGSMWTRMRSHKvelqQEGGAFRRM-IHKGNENEPP-IEYgDYIMDREPPEAVHD-ELDEEDSAAIIDWFYD 207
gi 667836817  152 PVFHAQWATMWVCMRREK----SDRRHFKRMrFPPFDDEEPP-LSWsENIEDVDPLEPIQM-ELDEEEDRAVIDWFYD 223
gi 255727639  184 PVYIAQWAATWNMMRREK----KDRKHFKRMrFPPFDDEEPP-LDWlENLEDVAPQDAIRL-K-EIENDEELQDWFYD 254
gi 927372991  201 PVYIAQWATMWLQMRREK----KDRRHFKRIkFPVFDDEEPP-INFsENIEDLEPLDAIQM-ELQDVEDLPVADWIYD 272
gi 123976938  118 PQYLAQWAETWIAMRREK----RDRHQIRRLrFPPFDDEEQP-LDFvTNIEGVEPPEAILM-ELDEDEDAAVYEWFYD 189
gi 501754129  152 PLYIAQWATMWIMMRREK----RDRRHMRRIrLPPFDDEEAPlLEQaQEMAELEPPEPIQM-EFDPEEDSAIAEWFYD 224
gi 149238566  281 PVYIAQWATVWELMRKEK----RDRKHFKRMqFPPLDDEEKF-LSWiENFDDADLPDAIQStEL--EADQFVGDWIYD 351
gi 398023633  143 PLYVSQWGSMWTKMRANKvellQEGGGFRRA-VHKGDENEPP-LDFaDYLMDRVPPPPVLD-DLDEEDNASIVGWFYD 217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap