Conserved Protein Domain Family
Abhydrolase_5

?
pfam12695: Abhydrolase_5 
Alpha/beta hydrolase family
This family contains a diverse range of alpha/beta hydrolase enzymes.
Statistics
?
PSSM-Id: 315383
Aligned: 6 rows
Threshold Bit Score: 236.195
Threshold Setting Gi: 81364782
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8Y715          63 SVILYPGAFVDALSYAPLANKLASSGYKTYIVEMPLNLAVFGKNRAADIIDEAPD-EKFVIGGHSLGGVMSSRFAH---D 138 Listeria mono...
Q186B9          89 GLILYPGAKVEIESYAPLARKIAESGYEVVIVKMPLNLAILGTNKAQKVMDSYNNiEHWVIGGHSLGGVAASNFAR---D 165 Clostridioide...
tigr:GBAA_3178  60 GVIFYQGAKVEAEAYSYLGEALAKDGHFVVMPKLPLNLAILGINEVDSVIEQYPKvQKWYVAGHSMGGAMISKYAF---Q 136 Bacillus anth...
Q5SMF4          64 LLAFYPGARVEPLAYAPVLAPLVGNGYLVVLLRVPQGIALLGQDRALEAGRAHPGlP-LVVGGHSLGGVVAAGVAA---R 139 Thermus therm...
Q839A3          67 ALIFYPGALVAPASYSEWAQEVATKGYDVYVVHFPLNLAVLAPNAAEQIIKDHPq-QNFVLAGHSLGGVMASRFVA---E 142 Enterococcus ...
Q9CG14          69 SIIFYQGALVDNKSYSIWANKLAKAGYTVYLIKEPLNLAVFNPDKASSIIK-TNKiNNYVVGGHSLGGVITSRFAEkriS 147 Lactococcus l...
Q8Y715         139 N-EnEIEGAFFLASYPDkKGSLKNASFP---ALSITATNDDVLNQDSYNKNKKYLPKDTTFVSIKGGNHAQFGSYGEQHG 214 Listeria mono...
Q186B9         166 N-K-LIEGVVFLASYPM-GDELKELGKK---VISIWGSKDGVVNFKSLVESKQKLPDDTTYVEIEGGNHAQFGDYGKQKG 239 Clostridioide...
tigr:GBAA_3178 137 HeD-KVDGIIFLGSYPA--DDFSTKSIP---MLSIYGEVDALATVEKIENNKKFMSKNTTMHMIKGGNHAHFGMYGEQKG 210 Bacillus anth...
Q5SMF4         140 E-G-L--PLVLFAAYPE-ED-LSQEAFP---TLALYGTEDGLLPPKEARRKAERLPRNARVVFVEGLNHAGFGAYGPQRG 210 Thermus therm...
Q839A3         143 N-EqRIKGMIYLASYP---DEKGALNKKnlpVLSITATNDGVLNWTSYQKAKQFLPKDTQYVSIEGGNHAGFGNYGVQKG 218 Enterococcus ...
Q9CG14         148 D-S-SLKGVFFLASYPDkKGSLTNFNGG---ILSIVGSQDGVLNWSSYQKAKQYLTQQTKYITIEGGNHSGFGSYGFQKG 222 Lactococcus l...
Q8Y715         215 DGKAAISGPEQTY 227 Listeria monocytogenes
Q186B9         240 DNDAIISQEKQLN 252 Clostridioides difficile 630
tigr:GBAA_3178 211 DNASLITSKAQRD 223 Bacillus anthracis str. 'Ames Ancestor'
Q5SMF4         211 DRPATRPREALWE 223 Thermus thermophilus HB8
Q839A3         219 DSKATISNEQQQT 231 Enterococcus faecalis
Q9CG14         223 DKKASISNLQQQE 235 Lactococcus lactis subsp. lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap