Conserved Protein Domain Family
7tm_4

?
pfam13853: 7tm_4 
Olfactory receptor
The members of this family are transmembrane olfactory receptors.
Statistics
?
PSSM-Id: 404695
Aligned: 4 rows
Threshold Bit Score: 372.99
Threshold Setting Gi: 190359996
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003734234  41 LCFMYLVSILGNCTILFIIKTERSLHEPMYLFLSMLALIDLGLSLCTLPTVLGIFWVGAREISHDACFAQLFFIHCLSFL 120 white-tufted-ea...
XP_006166505  33 FCAVYLIALTGNLTILFVIKTESSLHQPMFYFLAMLAAIDLGLSTATIPKMLGIFWIHLREIFFEACLTQMFFIHKFTLM 112 Chinese tree shrew
NP_001000160  34 FCLMYIIIFLGNGTILHVIRTEASLHQPMYLFLAILALAEVGVSASTLPTVLGLFLFDTTEITFEACLLQMFFIHSFSIM 113 Norway rat
Q9H342        34 FSLIYIIIFLGNGIILHVIRTDIALHQPMYLFLAMLALAEVRVSASTLPTVLGIFLFGNTEISLEACLFPDV-LHPFFIH 112 human
XP_003734234 121 ESSVLLSMAFDRFVAICRPLHYASILTNTVIGRIGLVSLGRSIALIFPLPFMLKRFSYCGSPVLSHS------------- 187 white-tufted-ea...
XP_006166505 113 ESAVLLAMAYDRYVAICNPLRYSTILTNKVVSVIGLGVSVRAFIFVLPFIFLILRLPFCGNHVIPHT------------- 179 Chinese tree shrew
NP_001000160 114 ESAVLLAMSVDRFVAIYSPLRYTAILTLPRIFRTGAIIGLKSVILMAPLPVLLRRLPFCGHNALSHS------------- 180 Norway rat
Q9H342       113 DGASCAAGHV--FGPLYSHLQPTELHSYP---DTAQGLWHRSYY---------RTEKHYAHGSVAHSlmasallwpqcpl 178 human
XP_003734234 188 -YCLHQEVMKLACADIKANSIYGMfVIVSTVGIDSLLILFSYSLILRTVLSIASRAERLKAFNTCVSHICAVLLFYTPMI 266 white-tufted-ea...
XP_006166505 180 -YCEHMGLARLSCASIKVNIIYGL-CAICNLVFDIIAIALSYVQILRAVFRLPSREARLKSLSTCGSHVFVILAFYTPAL 257 Chinese tree shrew
NP_001000160 181 -YCLHPNLIHLPCGDISINNIYGLfVVTSTFGIDSLLIVVSYGLILHTVLGITTGDGRKKALNTCGSHICAVLAYYVPMI 259 Norway rat
Q9H342       179 tFLLSAPQSYLSCGNISVNNIYGIfIVTSTFGLDSLLIVISYGLILHTVLGIATGEGRKKALNTCGSHVCAVLAYYVPMI 258 human
XP_003734234 267 GLSVIHRFGKQVPHLVQVVMGFMYLLFPPVMNPIVYSVKTKQIRDRVTHAFC 318 white-tufted-ear marmoset
XP_006166505 258 FSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQIYDCVKKILL 309 Chinese tree shrew
NP_001000160 260 GLSMVHRFAHHVSPLLQTMMANAYLFFPPVINPIVYSIKTKEIRRVIIRMLS 311 Norway rat
Q9H342       259 GLSIVHRLGHRVSPLLQAMMANAYLFFPPVVNPIVYSIKTKEIHGAIVRMLL 310 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap