Conserved Protein Domain Family
AJAP1_PANP_C

?
pfam15298: AJAP1_PANP_C 
AJAP1/PANP C-terminus
This family includes the C-terminus of adherens junction-associated protein 1 (AJAP1) and of PILR-associating neural protein (PANP). AJAP1 inhibits cell adhesion and migration. PANP is a ligand for the immune inhibitory receptor paired immunoglobulin-like type 2 receptor alpha.
Statistics
?
PSSM-Id: 317671
View PSSM: pfam15298
Aligned: 9 rows
Threshold Bit Score: 304.128
Threshold Setting Gi: 733918200
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0IIY7       165 ILWGPTGDDdV-----ESStfP--GIYETTRTStvh--arTTLLETTTTTT-----ASTTTNVKVTTLQNpgih------ 224 tropical clawed...
XP_008283306 178 IDWGPTGTD-Sid--dDGK--PdpNVTLSTRAS-------VTTVAATTSTT-----TRLSQRTLTVVTTP---------- 230 bicolor damselfish
XP_011471213 171 IDWGPTGTD-Svd--dDGKrgP--NVTLSTRAS-------SVTTATTAGTT-----PRLSQRTLTVVTTP---------- 223 Japanese medaka
XP_016853125 124 IVWGSTSPLdPl----ESStfP--GIYGSTTVSvlqrttrTTTTTATTSTT-----TFTTTAATPTTVQPkgpgpg---- 188 green anole
XP_007492140 172 IAWGPTGEEeSv----ESStsP--GIYGPTTVSilq--trKTTVATTTTTT-----------TSYITRQPkgftpslspv 232 gray short-tail...
XP_008541158 140 IAWGPTGEEeAl----ESNtfP--GFYGPTTVStfq--trKTTVATTTTTT-------TATTATSMTLQTkgvtep---- 200 Equus przewalskii
XP_010721013  10 IVWGPTGEEdSl----ESStlP--SIF-------------TTAATTTVTTT-----TAATTAATTVATVPtpsspa---- 61  turkey
XP_007239524 163 IEWGPTGTDeGle--dDVKavP--NTITTTKASt------TTTTTTTISTT-----TRSPQRTYAVVTTP---------- 217 Mexican tetra
XP_015192760 174 IDWGPTGGDdTstgenGDKpvP--NSTVARKPP-------TATAATIITTTvttksPRNTPKSPPVVTTT---------- 234 spotted gar
Q0IIY7       225 ---ngkkSP-GRIST-TdpnPGN---GK--TARPPRIPNDTSGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNAR 294 tropical clawed...
XP_008283306 231 -------ES-KSTTKpT---IGI---TE--TVKPPKPYGDTPGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNGR 294 bicolor damselfish
XP_011471213 224 -------ES-R--ST-TkspHSH---SE--TATPPR-HGDPPGLAVHQIITITVSLIMVIAALITTLVLKNCCSQSANGR 286 Japanese medaka
XP_016853125 189 -fgtprnNP-GGLST-MgppATSdgnRKevDAPPPKMPGDNSGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNTR 265 green anole
XP_007492140 233 isqnspnYP-GRIST-TessPGPqgnGK--DITPPRILGETSGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNTR 308 gray short-tail...
XP_008541158 201 -ldprnrIP-VGFST-TepsTSP---SK--D-KPPRILGETSGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNTR 271 Equus przewalskii
XP_010721013  62 -ptpgieEPrGRPST-SepaAGHssgGK--DARPPRGLGDTAGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGAAR 137 turkey
XP_007239524 218 -------HP-RRLST-TqptVNL---GV--TAKPQKPFGDTPGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNGR 283 Mexican tetra
XP_015192760 235 ----------RKLTT-TqssVSF---GE--TIKPPKPFGDTAGLAVHQIITITVSLIMVIAALITTLVLKNCCAQSGNGR 298 spotted gar
Q0IIY7       295 RNSHQRKINQQEESCQNLTDFTPASVPSNMDIFTAYNETLHCSHECIRTPVPVYTDEALHQTGAFKTTFNGNR 367 tropical clawed frog
XP_008283306 295 HNSHQRKIHQQEESCQNLTDFTPARVPSKVDIFTAYNDSLQCSHECVRTAVPIYTDEMIQQTPVYKTAYNGNR 367 bicolor damselfish
XP_011471213 287 HNSHQRKIHQQEESCQNLTDFTPARVPSKVDIFTAYNDSLQCSHECVRTAVPIYTDEMIQQTPVYKTAYNGNR 359 Japanese medaka
XP_016853125 266 RNGHQRKINQQEESCQNLTDFTPARVPSNLDIFTAYNETLQCSHECVRTPVPVYTEETILSPGDYKASFNGSR 338 green anole
XP_007492140 309 RNSHQRKINQQEESCQNLTDFTPARVPSNLDIFTAYNETLQCSHECVRTSVPVYTDETLHPTGEYKTTFNGNs 381 gray short-tailed opossum
XP_008541158 272 RNSHQRKINQQEESCQNLTDFTPARVPSSLDIFTAYNETLQCSHECVRASVPVYTDETLHPTGEYKSTFNGNR 344 Equus przewalskii
XP_010721013 138 RNGHQRKITQQEESCQNLTDFTPARVPSSLDIFTAYNETLQCSHECVRTPVPVYTEEALHSPGDYKATFNGNR 210 turkey
XP_007239524 284 HTSHQRKINQQEESCQNLTDFTPARVPSKVDIFTAYNDSLQCSHECVRTAVPVYTDEMIQHTPIYKTTYNGNR 356 Mexican tetra
XP_015192760 299 HNSHQRKINQQEESCQNLTDFTHARIPSSVDIFTAYNDSLQCSHECVRTAVPVYTDEMIQQTPVYKTAYNGNR 371 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap