Conserved Protein Domain Family
CCDC71L

?
pfam15374: CCDC71L 
Coiled-coil domain-containing protein 71L
The protein family, Coiled-coil domain-containing protein 71L, is a domain of unknown function, which is found in eukaryotes.
Statistics
?
PSSM-Id: 317741
View PSSM: pfam15374
Aligned: 12 rows
Threshold Bit Score: 453.515
Threshold Setting Gi: 972972942
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8VEG0         8 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKLQ 87  house mouse
XP_007499901   8 VEEKAVHSWSRISSAGQKALEEALLVFNPMSKDLSDTEAQLVAFLQGLREEGYQPTILRSKDVYGYSSCTADPPSQTKHH 87  gray short-tail...
XP_001506264   5 gEEKAVHSWSRISSAGQKALEEALRVFNPMSKNLADTETQLVAFLQGLREEGYQPTVLGSKDVYGYSSCTADTPEQTKEP 84  platypus
XP_015203492   8 VEKKAVHSWSRITSAGQTALLEALRVFSPMSKDLLDTETQLVSFLQGLKDEGHKATVLKSKDVYGYESCTAETPSVEKMS 87  spotted gar
XP_015423823   7 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLREDGFQPTVLRSGDVYGYSSCTATPPSQTKLH 86  Myotis davidii
XP_012428889   8 EEEKAVHSWSRISSAGQKVLEEALRVFNPMSKDLSDTETQLVAFIQGLKEEGYQPTILRSKDVYGYSSCTAVTPSQTEEN 87  zebra finch
ETE69870     100 VEEKAVHSWSRISSAGQKALEEALRVFNPMSKDLSDTETQLVAFLQGLKEEGYHPTILRSKDVYGYSSCTANAPGQTKGN 179 king cobra
XP_008103665   8 EEEKAVHSWSRISSAGQKALEEALRVFNPMSKDLSDTETQLVAFLQGLREEGYQPTILRSKDVYGYSSCTARMPSQTKGS 87  green anole
XP_004034181   8 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTANPPSQTKLQ 87  western lowland...
XP_003132253   8 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTANPPSQTKLQ 87  pig
XP_007632984  32 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLSATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTANPPSQTKLQ 111 Chinese hamster
XP_005006699   8 VEEKAVHSWSRISTAGKKALEEALLVFNPMSQDLNATEAQLVAFLQGLRDDGFQPTILRSGDVYGYSSCTASPPSQTKLQ 87  domestic guinea...
Q8VEG0        88 art--inPPATSL----PKTAVSVPAGRTTLLPVPLSGRLAKGSTAALAKH-ATTNLLLSSLKQSSASNSSGTTVGFPAH 160 house mouse
XP_007499901  88 -------VGPSTQakplPSDVPRATSRSLLAVPGTILGRSSKVSSSPIIKT-SSTNLLLNSLKQSGSGGGKNSSVGFPTH 159 gray short-tail...
XP_001506264  85 arntsraAAGLSAppdaPSGTPVAAMAEMLAVPGAVSVSSSKVPPSPTSKT-SSPNLLLNSLKQTESDTSKTATASFPAN 163 platypus
XP_015203492  88 kpl--dtTGKVTKvlkpVKKRARKTVAKKKEINYALLSAAAKLVLKNQPKI-LLTNLSQESLKRTVAVLSKPSASTVHVV 164 spotted gar
XP_015423823  87 ara--piPATTSPpasaPRAAVRLPAGRATLLPMPLPGRLAKASTPALAKH-AATNLLLSSLKESSASHARDTAMGFPTH 163 Myotis davidii
XP_012428889  88 tqr---scASTTEptqsPARN---SVAKVAPLPTSIPVSSLKVSNQQVSKG-DSTNLLLSSLKRTGSGTSKAATVGFPTS 160 zebra finch
ETE69870     180 ipdvsetAVPISEsakaPARNV-VTIEKVSAPLAGITVSSSKESAKPMSKSgNSTNLLLNSLKRTRSGTSKASAMSFPAN 258 king cobra
XP_008103665  88 gqd-tstAAPISEsakvPARNM-GTMSKASSPLAGIIVSSSKGSARPLSKNnNATNLLLNSLKRTRSRTSKDSAVGFPAN 165 green anole
XP_004034181  88 ara--pnPTATSPpasaPRTAMRLPAGRATLLPMPLSGRLAKASTPALAKH-ATTNLLLSSLKQSSASHARGAAVGFPTH 164 western lowland...
XP_003132253  88 ara--pmPAATSPpasaPRTPMQLSAGQATLLPMPLSGRLAKASTPPLTKH-ATTNLLLNSLKQSSASHAQGAAVGFPTH 164 pig
XP_007632984 112 art--tnPSATSLpsraPQTAVSLPASQATLLPVPLSGRLAKGSTPALAKH-ATTNLLLSSLKQSNASHTSGTTVGFPAH 188 Chinese hamster
XP_005006699  88 ara--pnPTATSPpasaPQTAVHLPTGRATLLPMSLSGRLAKGSTPALTKH-TTTNLLLSSLKQSSASRTRGATMGFPTH 164 domestic guinea...
Q8VEG0       161 LYPGVYPAMRLSVVLEALVPLKTP--CLDVKHGAqslqLSLAKSPLKVRKASG----NPKSKAPRKITS--------KGL 226 house mouse
XP_007499901 160 MYPGVYPAMRLSVVLEALVPLKATasCLNSKYKP----LGISNSDLKLLKGSG----RSRQSAPNKTTN--------KGH 223 gray short-tail...
XP_001506264 164 TYPGVYPAMRVSVVLETLVPLKSTanCLESKYNPg--hLGIANADLKLVKASG----APRLSTLGK-TA--------KGP 228 platypus
XP_015203492 165 NSTKMQPCLKLT---KLTAPSGSPtaRLQIHSELgslgISVPNSNWAPKPTGT----SAQPLENSGKTS--------KGP 229 spotted gar
XP_015423823 164 LYPGVYPAMRLSVVLEALVPLKTPvpHLGAKHETqslqLSLADSPLKLREGPGk-----RLAVPRKVTS--------TGP 230 Myotis davidii
XP_012428889 161 MYPDVYPAMRLSVVLEALVPLKTAtsCLESKYTRg--rLGISPSDLKRLKTSS----PPRQFSSGKSTKit----egKGY 230 zebra finch
ETE69870     259 MYPGVYPAMRLSVVVEALVPLKATasCLESKCKQg--hLEISPSDLKRLTAST----ASMQSSAVKATKippnqldpKGY 332 king cobra
XP_008103665 166 MYPGVYPAMRLSVVLEALVPIKATasCLESKCKQg--hLGISSSDFKLLKAAS----GSRQSATIKATKlspnqldsKDY 239 green anole
XP_004034181 165 LYPGVYPAMRLSVVLEALVPLKTPmpCLGAKHKAqslqLSLADSPLKLRKSSGkgpgNPRPKATRKTTS--------KGP 236 western lowland...
XP_003132253 165 LYPGVYPAMRLSVVLEALVPLKTPipCLSAKHKAqsvqLSLADSPLKLRRGPGkspgNSQPKVPRKATS--------KGP 236 pig
XP_007632984 189 LYPGVYPAMQLSVVLEALVPLKTP--CLGAKHRAqspqLSLANSSLKLRKGSG----NPQSKASQKITS--------KGI 254 Chinese hamster
XP_005006699 165 LYPGVYPAMRLSVVLEALVPLKNPmrCLNAKHKPqslrLSLANSPLKLQKGSGkspeKSCSKAPRKTTS--------KGA 236 domestic guinea...
Q8VEG0       227 KHLTSKGPGA---------GL-------RRGAGTQSN---------GAqrkgcsaLGPKTVQAQASQtlikaARAHASva 281 house mouse
XP_007499901 224 RCLIRKAPDRaalpkggrrGP-------SGGVLRESNackasgilnGR-------RRKKGTQVKTSKrgartACRGGR-- 287 gray short-tail...
XP_001506264 229 QNVVKKTRlaeg----flrSP-------GGRVLQESNackasgilnGR-------ISSSSSQGCSGG----------Sps 280 platypus
XP_015203492 230 QADKMRVSSCpvkmavalvGDsttvtcqNDRVLKESNsykm---vpvR-------IGK----------------TNAPgd 283 spotted gar
XP_015423823 231 KCVIRRGPSA---------GP-------QESTGPQSKtcratgsllGPqmkgvsaLSTKTAQAKAAQalarvACAQATaa 294 Myotis davidii
XP_012428889 231 KRLVKKAPDSatcalkllkGP-------NGGVLQESNackasgvlnGR-------VAGSSSQ----------DCATAPqp 286 zebra finch
ETE69870     333 RHLITKVPDSaaltmslikGP-------KGGVLQESYackasgilnGR-------ISGSHSQ----------SCSTGAsr 388 king cobra
XP_008103665 240 RHIIKKVPDStsltvslmkGP-------KGGVLRESNackasgilnGR-------ISGSPSQ----------SCSQAAtr 295 green anole
XP_004034181 237 KCLTRKGPGA---------GP-------RRGSGHQSKtnratgspsVRrmkggsaLGTKTAQAKVARtlakaAHAQAKva 300 western lowland...
XP_003132253 237 KGLTQRGSRA---------GP-------RQGNGPQNKtykatgslsSPrmkggcsLGTKIAQAKAARaqakvARTQAKva 300 pig
XP_007632984 255 KCLSRKGPGA----------D-------PQGSGPRSS---------GLrvkgcsaLGTKTVQAKASRtltkaAHAHASla 308 Chinese hamster
XP_005006699 237 TCLTHKGSRA---------GP-------QQGTGSQRKtckaigsvrGLqmkegstLGTETAQVKATRtlakaAQNSGNva 300 domestic guinea...
Q8VEG0       282 qtqtktvrvrakakqakpkaarakakaavvrdk-------------------akdkviqakakaaqtkhkgkpkgsvqtr 342 house mouse
XP_007499901     -------------------------------------------------------------------------------- gray short-tail...
XP_001506264 281 kaprskapd------------------------------------------------------------------vpvgr 294 platypus
XP_015203492 284 klgwsdk-----------------------------------------------------------------------ds 292 spotted gar
XP_015423823 295 qtqakaakaraetkaawikakakaraararaka------------------karaarataartqprgrgrgrlkgsvqar 356 Myotis davidii
XP_012428889 287 ktlkikdke------------------------------------------------------------------vlvgk 300 zebra finch
ETE69870     389 ikepsv------------------------------------------------------------------------ak 396 king cobra
XP_008103665 296 nkepsv------------------------------------------------------------------------dk 303 green anole
XP_004034181 301 rtqaeaakaqakakaarvkakakakaarvkakakvmaara-----rakakakakavrakakvartqprgrgrpkgsakar 375 western lowland...
XP_003132253 301 karakakaaqikakakaararakakakavqakakakaarararakskavranakavqakakvariqprgrgrpkrsvqar 380 pig
XP_007632984 309 rtqnktvrvrakttktkpraagakakatvvrnk-------------------akakvvkakakaaqtkhkgrpkgsvqnr 369 Chinese hamster
XP_005006699 301 riqakakaardkakakairdkakakairdkakakairdka----kakaawnkakakaarnkvaqiqlkgrgrpkasvqps 376 domestic guinea...
Q8VEG0       343 tgranrKNSSETVG-RKRKKAEETKG-LPPKKRARCVPRPPKVWLGPG------TAKPRKSQTIKVDRKCSDDEVRQCAQ 414 house mouse
XP_007499901 288 ------GSHPEATG-PKRKRAEEAKE-TPAKKKSKLGPGLSKARLVPS------SPNLLKFRVIKVNKRFSDEEVRQRAQ 353 gray short-tail...
XP_001506264 295 idwrdgSDDPRETGaRKRKRAEAVKE-PPPKKKTKSVPCLTKSELGQS------TLNLLKFWIIKVDKTSSDDEVRQRAQ 367 platypus
XP_015203492 293 vrvlncQPDVEV---RKRKRLEEPEE-PTAKTRPRNG-----SWVGNGqdesglNENNLRFKVIKVDDSITDEEVRRKAQ 363 spotted gar
XP_015423823 357 tarkgqKGSPGTGG-QKRKRTEEAKD-HLPQKRARLGARSPKARLRLG------TSTLLTLRAFKVDQRSSDDEVRRQAQ 428 Myotis davidii
XP_012428889 301 tewkdsSTYQESTG-QKKRKATEAKE-APQRKKTNTIPVRKKTQQVQS------TLNLLKFRTIKVGNSSSDDEVRRRAQ 372 zebra finch
ETE69870     397 teresgGSHQQAIG-EKRRSADEGKElLPRRKTPSSVPPPNKPELASK------AFNLLKFQAIKV-DSSSDDELRRRAQ 468 king cobra
XP_008103665 304 tgwrggSSLQETAG-QKRKRGEERKE-LSCRKNPSSVPSPSQVELHSK------TLSLLKFQAIKV-NSSSDDELRRRAQ 374 green anole
XP_004034181 376 ttrkgqKNRPETVG-QKRKRAEEAKD-LPPKKRTRLGPRSPKAWLGPG------TAKLLKFRAIKVDRRSSDDEVRQRAQ 447 western lowland...
XP_003132253 381 tarkgqKRCPETVG-QKRKRADEEKD-LPPRKRTRLGPQSPKMWLGRG------TAKLLRFQAIKVDRRSSDDEVRQQAQ 452 pig
XP_007632984 370 tgrtslKSGSESVG-KKRKKAEEVKG-LPPKKRARLVLQSPKARLRPG-------AKPQKSQTIKVDRKFSDDEVRQWAQ 440 Chinese hamster
XP_005006699 377 msrkaqKSHSVTLG-QKRKRAEEAKD-LPPKKKKRLESQSPKSCLGSG------TAKLIKFRAIKVNRQSSDDEVRQQAQ 448 domestic guinea...
Q8VEG0       415 QILRVNLSPVVWLQPL 430 house mouse
XP_007499901 354 KILRVNLSPVIRIQPL 369 gray short-tailed opossum
XP_001506264 368 KILRVNLSPVIRIHPL 383 platypus
XP_015203492 364 KILQVNLSPVIEIRPL 379 spotted gar
XP_015423823 429 RALRVNLSPVIRLQPL 444 Myotis davidii
XP_012428889 373 KILRVNLSPVIQIQPL 388 zebra finch
ETE69870     469 QILKVNLSPVIRIQPL 484 king cobra
XP_008103665 375 RILRVNLSPVIRIQPL 390 green anole
XP_004034181 448 RILRVNLSPVIRLQPL 463 western lowland gorilla
XP_003132253 453 QILHVNLSPIIQLQPL 468 pig
XP_007632984 441 QILRVNLSPVVWLQPL 456 Chinese hamster
XP_005006699 449 QILRVNLSPVVRLQPL 464 domestic guinea pig
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap