Conserved Protein Domain Family
Tox-HNH-HHH

?
pfam15637: Tox-HNH-HHH 
HNH/Endo VII superfamily nuclease toxin with a HHH motif
A predicted toxin of the HNH/Endonuclease VII fold present in bacterial polymorphic toxin systems with characteristic conserved s[GD]xxR and HHH motifs. In bacterial polymorphic toxin systems, the toxin is exported by the type 2, type 5, type 6, type 7 or Photorhabdus virulence cassette (PVC)-type secretion system.
Statistics
?
PSSM-Id: 317946
View PSSM: pfam15637
Aligned: 2 rows
Threshold Bit Score: 246.218
Threshold Setting Gi: 81721769
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q82QU7 243 PVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYFWPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAA 322 Streptomyces avermitilis
Q82QU7 243 PVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYFWPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAA 322 Streptomyces avermitilis
Q82QU7 323 YVNDTLEHHHVGQGSRAVPLPSRLHDAYTVFHPQ 356 Streptomyces avermitilis
Q82QU7 323 YVNDTLEHHHVGQGSRAVPLPSRLHDAYTVFHPQ 356 Streptomyces avermitilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap