Conserved Protein Domain Family
S6OS1

?
pfam15676: S6OS1 
Six6 opposite strand transcript 1 family
This family of proteins is found in eukaryotes. Proteins in this family are typically between 114 and 587 amino acids in length. The function is not known.
Statistics
?
PSSM-Id: 317979
View PSSM: pfam15676
Aligned: 9 rows
Threshold Bit Score: 775.933
Threshold Setting Gi: 620988223
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001492690 200 CVEDIKENKATICKIHETINTTDEEIGHYCKHSKEIKDNCSNWKPTCDVFHKHEDYMQDQFTIYQETVEKDKKMYHGYIC 279 horse
XP_007473034  36 FCTNIKEKKRNIFTLRDKINTSDDEIDHYHKHNKYMKKDCINWMPTNDVLHKHEDYLQEQFQNHQETTEKDKKMYHDYMR 115 gray short-tail...
XP_012396460  36 FYKNIKEKKKSIFSLHDKINAIDNEITHCRKHNKYVKENCANWMPTYDILHKHEVFLEDQFQNDQETTEKDKKVYHDQMR 115 Tasmanian devil
XP_007657728  37 CSAKVLESKKCILKLHENINKSDDEIVSYQKHKEHFKDSCINWKPTYDVLYKHENYLQEQFQKHQESTEKDKKMYHDYMS 116 platypus
XP_012962522  58 YSVKITEKRNEIARLKENINNSNEAIADLRKQNENSKDSCNAWKPTYAILSKHEEYLKNELEVLQEATENERKMYQDYII 137 mallard
XP_003206834  30 YSSKITEKRNEIARLQENLNNCNDAIADLRKQNENSKDSCNAWKPTYAILSKHEEYLKNELEVLQEATENERKMYQDYII 109 turkey
XP_017170727  37 CLESIKENKANVSKLREAINKVDEDIAFHYKHSKEIKDSCSNWKPTCDVFHKHEDYIKDQLTAYQETNEKDKKMYHDYIC 116 house mouse
XP_003408737  37 CFEDIKENKKIICKIHETINTTDEEIGYYCKHSKEIKDTCTNWKPTCGVFHKHEDYMQNQFTVYQETVEKDKKMYHSYVC 116 African savanna...
XP_012921187  37 CLEDIKESKETICKIHKSINKTDEEITHYCKHSEKIKDSCSDWKPTCDVFHKHEDYMQGQLTIYRETIEKDKKMYHGYIS 116 naked mole-rat
XP_001492690 280 QYKDVLKQYQLKYSETPFSHEYYEKKREHEEIQNRVLACTEQLKMNETIFMEFLVPAPFPSRTKWTLHIVNLRYKTQDIL 359 horse
XP_007473034 116 QCNDTLKQYQLHYSESSFAQEYYKNKTEVEEIKSRIITCSEQCKIKETILMELIVPAPFKSLPDWALQIVHLRSKTEDIL 195 gray short-tail...
XP_012396460 116 QCKDVLKHYQLQYSKAPLAQKYYKDKTQVEELKNQILACNEQCTIKETILLELSVPAPFKSLSQWALQIVHLRIKTEDFL 195 Tasmanian devil
XP_007657728 117 QHKKVFAQYQITYSERTLAKEYNRKKAEFEVIHNRVLSQTEKFKLKETTLMELLVPAPFRSLPHWALLIANLRYKTEDTL 196 platypus
XP_012962522 138 QYKEILEQHREKYAETPLAQECSKKKKEIEEIQNRILKQSEQYKLKEDACSDILEPAPFKSFNDWALHIASLRQKTQEML 217 mallard
XP_003206834 110 QYKETLKQHREKYAETALAQEYYKKRXEVEEIQNRIQKRSEQYKLKEDADLDVLEPAPFKSINDWALYIASLRQKTQEVL 189 turkey
XP_017170727 117 QYEDVLKQYQLKYSETRFSCKYYEKKKEHEEIKNRVLACTEQLQLNETILMKFLVPAPFPSLTKWTLYVVNLRYRTQDIL 196 house mouse
XP_003408737 117 QYKDVLKQYQLKYSEAPFSREYYEKKTEHEKIQNRVLACSEQLKMNETIFMEFLVPAPFPSLTKWTLHMVNMRCKTQEIL 196 African savanna...
XP_012921187 117 QYKDVLKQYQLKYSEIPLSRDYYEKKREYEGIQNRALACTEQLKTNEIMLKEFRVPASFPSLSKWTLYIVNLRFKTEEIL 196 naked mole-rat
XP_001492690 360 KLANNFSKSSSELKKEVDEMEIEINYLNQQIARLYETKNLSETLEEKN-KNIEKKKELKERIFEKDEQHiLTLNKAPQKS 438 horse
XP_007473034 196 KYASTLICKSSTLKKEADEIERKINYLNQQTARISETKNLSKVLEDKS-DKIEKTKEFKERIFEEHGRI-CELNEDLQNS 273 gray short-tail...
XP_012396460 196 KCASTLIHKTCKMKEEIEEMER-----NQETERISEAKNLPEVLEEKN-KELEKTKECEGRIFEEHGHF-RVLNENPQSS 268 Tasmanian devil
XP_007657728 197 KQAASVTQKSLLLKKESEEMETKLRSLKNQVVQFSEVK---KPIENTE-KKIEK-NPFKSRISEGLERR-RRYQRN---R 267 platypus
XP_012962522 218 KLAEVATQESVELEREAEELEMKINYFKKRFEETTEDQNDSEMVEGKNlKSLEKPKNFKERIFEESEHPsLLNEKHQLYK 297 mallard
XP_003206834 190 KLAETATQESTELEKEADEIEMKINYFKKTFEKTTEDQNNSEMIEGKNlKSLEKPKEFKERIFEESEHPsFLHEK-QLYK 268 turkey
XP_017170727 197 KRANNFTKRSFELEKEADDMEIEINSLNKQMARLFESKTFSEALDEKN-KNTEKRKEFEERIFEKDEQ---VSNRSSQNS 272 house mouse
XP_003408737 197 KLANNFTRSSSELEKEVDEMEMEINYLNqQIARLYETKNLSETLKEKN-NIIEKRKELKERIFEKDEQg-LVLEKKHQNS 274 African savanna...
XP_012921187 197 KHANNFTKNSSQLKKAINEAEIEINYLN-KIIRLYESKNLSETPEENH-KNTEKRKELKERIFEKDEH---IFSETPQSS 271 naked mole-rat
XP_001492690 439 QLFLPYESQKLVRPI--KMHSSEPKVIDKKEESSVKQSKLANIDFR--QKENDTQVFNDSTVNNHskcSHVAAIKSSQNF 514 horse
XP_007473034 274 KLFLPYNSQKLVKPVgnERHFPEPRGTDKKEESSLSYSTLAKIDFRpeRKATPTPEFDESMMNKY---SQVSSLKSTQNL 350 gray short-tail...
XP_012396460 269 QLFLPYNYQNLVRPVrnDRHFSEPGGTDKKEGSS-SHSTLARIDIR--PERKEILEFDVSVMNKY---SQVSPHKSTQNL 342 Tasmanian devil
XP_007657728 268 KVFPLFSSLKSVRPKkrSKPFLELRKPGKRGVRSSGSSSLARISVN--QEENEGKECNDSAVSKLskyDQLAASVNLQEL 345 platypus
XP_012962522 298 PLHLPCIPRKSVQSVqtIRFSMKRMDKGREEKEKHMEHSLATSSSSs-HAENPSQMVMDTAWTNNlqiAQVPSTASLQSQ 376 mallard
XP_003206834 269 PLQLPCIPRKSVQSLqtTRFSMQQTETGREEKENPMEQAVAASSSSs-HAENPSQMVIGTAATTNlqvAQVPSIASLQSQ 347 turkey
XP_017170727 273 QLLLPCESQKFVR----NMNSSEARVTDKKEESSANQSKFVRSDVR--QKENNPQIFNDSGMDSNsksSHIPAVKSSQGF 346 house mouse
XP_003408737 275 QLFLPYESQKFIRPV--KMHSSELRVTDKKEEGSV---KLANVDFG--QKENDRQIFNDSAVNNHskcSPVPAIKSLQNF 347 African savanna...
XP_012921187 272 QLYLPYESQKLVRPI--KMQSSEPKVTDKRAESSVKQSKLATMDFR--QKENNTQVSSDSDVNNN---SHVTTIKSAHSF 344 naked mole-rat
XP_001492690 515 MQFRLLTPQKQSNCNQWFEK-----G-DTDA-----ECGDKGTVR--QLRESKCASQVLYAEHFGKPIEDNSDE-VEERA 580 horse
XP_007473034 351 LQLRLLTLQKQSDYKLMFDK-----G-STDS-----EGGIKETEK--KLKDSTDTLQGGHTEYLGKSVEDNHDK-TEGSP 416 gray short-tail...
XP_012396460 343 MQFRLSCLEKQSNYKQTFDK-----G-NTDS-----EYGKKETER--ELKDSAVLPQDSHTEHMDKLVEVSHDE-TEENT 408 Tasmanian devil
XP_007657728 346 LQFRNPTAQKPSNYKKSFDR-----G-ERDA-----ECQDENPKR--AVNDSTCISHDTSAENFGESKEDYPVA-VYKNI 411 platypus
XP_012962522 377 MQFRQGVPPKQVTTNQQFESedtaiE-DQEA-----KCDDKEAED--EPKDSSYIPQKIHT--YFKSNENNPDT-AEESA 445 mallard
XP_003206834 348 MQFRLQRPPKQVTANQQFES-----E-KNVIenqeaKCDDKE--AadEPKDSSYIRQDTRT--YFKPNENNPDTaAAEGA 417 turkey
XP_017170727 347 MQFRL----NQPNYNQRIEK-----E-HIDA-----ECGDKETVR--QVRESKCSTQALYIEHFGKSIENNSVE--EERD 407 house mouse
XP_003408737 348 MQFRLL----TPQKQSDCHQwf--eKgDTDA-----ECGGKETVR--KLRESKCTSKAIYSEHFGKPVENKNNE-VEERT 413 African savanna...
XP_012921187 345 MQLRL-TPQKQSNYNQWFEK-----G-HTDA-----ECGDKGTGR--QVRESKHTSQGVCTEHSGKSIENNSDK-VEEMA 409 naked mole-rat
XP_001492690 581 ENFPRTPEIPLFLRTPEAVKTPES-LEKLVFPKTPTFEInrNRNTIPEGQTQKESPGFSFIMSyTSRSPGLNLFDSSIFD 659 horse
XP_007473034 417 EKLTSTPEMPQFLRTPDFLKTPEH-GEKLEFSKSPSSEL--LRNIGLEGKSQKTPPAFSFLMG-SSVSPGFNLFESSDFG 492 gray short-tail...
XP_012396460 409 EKFPSTPEMPPFLRTPEFLRTPEC-VEKLEFSKSPSSEL--LRNIGFEGKTQKTPQAFSFLMG-SSISPGFNLFESSEFG 484 Tasmanian devil
XP_007657728 412 EQFPCAPKSSSVGRNTEILRTSEStVMEGQLPLTSPFVL--DQNIDSEGPNQDASPTIPFFLTsATQSPGFSFFDSALFT 489 platypus
XP_012962522 446 EHFPRTPE------TPEFVGTPDSkGKKTQFSKTPPFDF--IHNFGCEEGTSK-SPAFFSLMNfSQKSPGFNLFDSSVFG 516 mallard
XP_003206834 418 ERFLRAPE------TPEFVGTPDSkGKKTQFSKTPPFDf--IHNMGCEEATSK-SPAFFSLLGiSQKSPGFNLFDSSVFG 488 turkey
XP_017170727 408 ENFPQTPETPSFLRTPEALKTPES-MEKMQFPKSPFFEI--TKNATSEGHKQKDSPGFSFLMSyTSRSPGLNLFDSSVSD 484 house mouse
XP_003408737 414 ENFPKTPEIPLSLRTPEAVKTPES-LEKLQFPKTPSFEInrNRNIVPESQTQKESPGYSFLSSyTSRSPGLNLFDSSIFE 492 African savanna...
XP_012921187 410 ENIPQTPDIPIFLRTPEAIKTPES-LEKIQLPKTPSFEI--NRNVVPEVQSQTESSGFSFLMSySSRSPGLNLFDSSIFD 486 naked mole-rat
XP_001492690 660 SEISSDQFNE--HSAGNLNPLSSQQEIGNLFGKPEGEDGFTFSFPSDSSTHTFGAGKDDFSFPFSFERDQNST-PSSVKG 736 horse
XP_007473034 493 NENLPDQFDEn-YSSENLNPVSSQKDIGGLFGKLEGEDTFPFPFSSEASTQPFEDGKDDFTFSFSFEQDQHSShSSSSKG 571 gray short-tail...
XP_012396460 485 NENLPDQFDEn-YSSGNLNPVSSQKDIGGLFGKLEGEDTFTFPFSSEPSTHTFGDGRDDFSFSFSFEQDQRSShSSSNS- 562 Tasmanian devil
XP_007657728 490 GD-SPNQFAEn-YSAENFNRGSSQKDIGDLFGKLE-EDTFTFAFPTESSTHKFEGGKDDFSFSFPFESDQSLQpCSST-- 564 platypus
XP_012962522 517 AEHSSDETDDn-YPVGHLNPMSPQKDFGSLFGKSESEDAFAFPFPSDSTSHAFGDGKDDFSFPFAFGQDQRSSqSPSVQG 595 mallard
XP_003206834 489 AENSSDEIDEg-YSVGNLNPMSPHKDFGSLFGKSESEDTFAFPFPLESTSHAFGDGKDDFSFPFAFGQDQRSSqSPSVKG 567 turkey
XP_017170727 485 SEISSDQFNEh-YSAVNLNPSSSQQGIGNLFGKSEGEDAFTFSFSSDSS-HTFGAGKDDFSFPFSFEQDPSTMtSSSSKD 562 house mouse
XP_003408737 493 SEISSDQFNEr-YSGANLNSLSSQQEIGNLFGKSEGEDAFTFTFPSDSSTHTFVAGKDDFSFPFSFEQDQNVTySSSLKS 571 African savanna...
XP_012921187 487 SEMSSDQLSEhrHSAVNLNPPSSQ-EIGNLFGKR--EDAFTFSFSSDTSTRTIGAGKDDFVFPFSFEQDKNSI-PSSSEG 562 naked mole-rat
XP_001492690 737 fSSSSQNTTQFTFF 750 horse
XP_007473034 572 -FPSSQNTKQFTFF 584 gray short-tailed opossum
XP_012396460 563 -FPSSHNAKQFTFF 575 Tasmanian devil
XP_007657728 565 --SSPQTTKQLIFF 576 platypus
XP_012962522 596 fHSSLQNTKPSTFF 609 mallard
XP_003206834 568 fHSSLQNTKPSTFF 581 turkey
XP_017170727 563 f-SSSQNKTQFMFF 575 house mouse
XP_003408737 572 fPSSSQNTTQFPFF 585 African savanna elephant
XP_012921187 563 fSTSSQNTTQFSLF 576 naked mole-rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap