Conserved Protein Domain Family
Phosphatase

?
pfam15698: Phosphatase 
Phosphatase
Members of this family have phosphatase activity.
Statistics
?
PSSM-Id: 318000
View PSSM: pfam15698
Aligned: 23 rows
Threshold Bit Score: 345.427
Threshold Setting Gi: 503902495
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q82CR1        12 LVDHLVRTRIAGDVATPRENNLSHYRKLANGDRNYWLGLELGDRWSdEQDVLAVMAERCGVNDDPEYRYGQDTIDPELTV 91  Streptomyces av...
Q47LD3         9 LIDYLVTTGIAGQVATPRQNNLKHYRRLVEGDPYHQFGLTFQRKWT-FSDVLALMAQRCGVVADEDYVQGIDTIDPDRTV 87  Thermobifida fu...
WP_014142608  12 LVDHLLRTRIAGDVATSRENNLDHYRELAAGNRYYWLGLDLGTRWTdEDAVLELMAQRCGVVADRDHRAGQDTIDPQLTV 91  Streptomyces ca...
WP_012854761   9 LREHLIRTMIAGDVATPRQSNLLHYRRMAKGDPYYRFGLDLKRSWT-EREVLEMMVRMCGVNPDRMHLYGDDTIDPDKTI 87  Thermomonospora...
WP_012397733  11 LARYLDRSRITGAVATPREANLRNVQGFLDGDQHQHMGVERTREWD-FDSVFGLMRDRVGINDDPSYVSGQDSISAQLCV 89  Kocuria rhizophila
WP_013397594  10 fAAYLDSARITGDVATPRENNLSHIQGFLDHNEHLEFGVTWSKDWT-YDEVFEVMVRRVGLNPDRSHVQGQDTIGAAQCI 88  Rothia dentocar...
AFT98808      16 LRKHLLKAKIAGEVATPREGNLAHYRRMVDKDPAYQFGLALK-DWT-FTETLAMMAQLCGVNPDPRHRHGQDTIDPELTL 93  Nocardia brasil...
WP_013155994   9 LITYLVRTGIAGHVDTPRQNNLRHYRRLVQKDPYHQFGLTFSHDWT-YSEVLALMSKRCGVVADEEYVWGIDTIDPDLTI 87  Nocardiopsis
ACZ83560      18 LREHLVRTRIAGDVATSRENNLDHYRSLSNRDPHHMFGLTLEGHWA-YRDVLALMAKSAGVVADPEHREGQDVIDPDRTI 96  Streptosporangi...
WP_015033767   9 LVEHLVRTRIAGDVATPRDNNLSHYRKLANGDRHYWLGLELGDRWTdEQDVLAVMAERCGVIDDPAHRTGQDTIDPELTV 88  Streptomyces ve...
Q82CR1        92 DALDRMAARLRKAAA-GRQRVLFATGHPGGLLDVHRATAAALRTAGCEIV--------VIPEGLQT-DEGYVWQLAD-VA 160 Streptomyces av...
Q47LD3        88 DALEVVAERLAQAAR-DRERIMVATGHPNNLAELYRAWKDVLVDHGCTVVtaaagysyDAPGGPPP-TRRTLVWRDD-VG 164 Thermobifida fu...
WP_014142608  92 DALDRMAVVLRKAAA-GRQRVLVATGHPGGLLGVHQATVAALRQAGCEIV--------AIPEGLPA-DDGRVLQISG-VA 160 Streptomyces ca...
WP_012854761  88 DALERMAERIGQAAR-RREKVVLATGHPATLMPIYLALGRALRERGCTVLtpaagwsyAAEVGTSApQRRRIRYEEGmVA 166 Thermomonospora...
WP_012397733  90 ARLDEYAEIFSRAVQ-GRKRLLFATGHPSGLAPVYARLARVARASGARVI--------RFDEALPF-EDGDVRQIED-VV 158 Kocuria rhizophila
WP_013397594  89 DALEEYARIFGDAVR-ARQKILFATGHPAGLFPIYAELARVAERAGATVL--------RIEQGERF-LDGDIRQIMG-VV 157 Rothia dentocar...
AFT98808      94 DALDAMGARIGRAAD-RQETVLLATGHPGPLMGVYRAIEDALRGNGCTVLtpaagwsyRIATPNGA-ARREIVYTSR-VA 170 Nocardia brasil...
WP_013155994  88 DALEAFADRLALAAE-RRERVLFATGHPRNLRETYRAWKDALAERGCQVLtagggysyEVTTERPP-NRRIVVWEDD-IA 164 Nocardiopsis
ACZ83560      97 DAVEAMGDTIAGVLRtGGPRILFATGHPTGLLTIHMALARLVREHGAILMgpae--gwsyWSAGFG-RKRQIRYMDD-VA 172 Streptosporangi...
WP_015033767  89 DGLERMAARLRKAAA-GQERVLFATGHPGALIDVHSRVAAALRAQGCDIV--------RIPGGLVA-DEGYVVQFAD-VA 157 Streptomyces ve...
Q82CR1       161 MLE-HGASLWHTHSGEPMRAVLNGLER-----------AGRPLPDLVVADHGWAGCAG-QLGVDSVGYADCNDPALFLAE 227 Streptomyces av...
Q47LD3       165 MVT-DGTEPQHSHHPFAMRAVLAQLSE-----------TGGPWPQLVIADHGFAGAAG-EAGVPTIGFADSNDPALFLGE 231 Thermobifida fu...
WP_014142608 161 MVL-RNAALVHTHSPEPMTAILDALEG-----------SGRPLPHLVVADHGWAGCAA-QRGIDAVGYADCNDPALFVGE 227 Streptomyces ca...
WP_012854761 167 ALEdDDGRLHHTHDPFPMEAMLSEAAGtsngsdsstpaESKNWPDLAIADHGWAGAAG-QAGIDTVGFADCNDPALFAGE 245 Thermomonospora...
WP_012397733 159 MVE-QYGGLRHTHFPEPMRLVLEHLQE-----------QGRQAPDLVIADHGMAGWAGsRAGLPTIAMGDCNDPGIFVAE 226 Kocuria rhizophila
WP_013397594 158 MFE-QYGNLQHTHFPGPMRIALAQLRE-----------RGE-LPDLVVSDHGMAGYAAsQQKLLTLGIADCNDPGLFIAA 224 Rothia dentocar...
AFT98808     171 ALG-TNGYLKHTHDPQPMQAMLHELAD------------GAGWPDLVVADHGWAGAAG-EAGIDTVGFADSNDPALFAGH 236 Nocardia brasil...
WP_013155994 165 IVT-DGRLARHSHHPFAMRAILADLAD-----------RGEAWPQLVIADHGFAGAAG-EAGVPAMGFADCNDPALFLAE 231 Nocardiopsis
ACZ83560     173 MLA-DRGTFVHTHDPAPMRAMIDELGD--------------DRPDLVIADHGWAGAAG-EAGILTVGFADSNDPALFVGE 236 Streptosporangi...
WP_015033767 158 VFE-RGASLWHTHSPEPMNAILDGLGE-----------DGR--PDLVIADHGWAGRAG-QRGIDSVGYADCNDPALFIGE 222 Streptomyces ve...
Q82CR1       228 SEGTVQVTVPLDDHVKsPRHYDPMTAYLLSGAGL 261 Streptomyces avermitilis
Q47LD3       232 HEGKLHVTVPLDDGYV-PDEYRPLSDYVIYRAGL 264 Thermobifida fusca YX
WP_014142608 228 AEGTLAVTVPLDDHVP-PHHYEPMTAYLLNAAGL 260 Streptomyces cattleya
WP_012854761 246 VEGRILVTVPMDDGVH-PACYEPLTAYLMSHAGL 278 Thermomonospora curvata
WP_012397733 227 AQGQVEVVVPLDDNVA-PHLYDPLVDYIISRAGL 259 Kocuria rhizophila
WP_013397594 225 EQGDLPVCVPMDDNVP-PNRYEPLIDFLVNHASL 257 Rothia dentocariosa
AFT98808     237 AEGKIAVTVPLDDGVF-PEYYEPLTTYLLDRAGL 269 Nocardia brasiliensis ATCC 700358
WP_013155994 232 AEGKLLVTVPLDDGYL-TEDYAPLREYVLARAGL 264 Nocardiopsis
ACZ83560     237 AEGKIAVTVPLDDNVL-PRYYDPLTRHLVERVVR 269 Streptosporangium roseum DSM 43021
WP_015033767 223 AEGTMQVTIPLDDHVLdPRFYEPLTAYTLNAAGL 256 Streptomyces venezuelae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap