Conserved Protein Domain Family
DUF4689

?
pfam15755: DUF4689 
Domain of unknown function (DUF4689)
This family of proteins is found in eukaryotes. Proteins in this family are typically between 202 and 224 amino acids in length.
Statistics
?
PSSM-Id: 318051
View PSSM: pfam15755
Aligned: 8 rows
Threshold Bit Score: 273.275
Threshold Setting Gi: 126335567
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5BK39         1 MPATPQQPSGHTEGltEPTSEAAMWVVIPCGPCIPIMLGLASLTAFFIITTAVLAERLFRR-PQPDP-SQRAPTLVWRPG 78  Norway rat
XP_001367996   1 MSAPLEQLPGQVEN--PVMHQPSQWPPILCGPCIPIMLALALLAAIFLLATAVLAERLFRRsLRSDP-SVGRPSLVWRPG 77  gray short-tail...
XP_001501645   1 MPSTPGQPSEHMEG--PPVLEAASWPPLPCGPCIPIMLALASLSALFLLTTAVLAERLFRRsPQPDP-RNQAPTLVWRPG 77  horse
XP_003418898   1 MPSTPGQPTGHMEG--PPASESASWSPLPCGPCVPIMLALACLAALFLLTTAVLAERLFRRsPRLDP-SNRTPTLVWRPG 77  African savanna...
NP_001181186   1 MPSTPEPPSGRMEG--PPTWEAAPWPSLPCGPCIPIMLALATLAALFILTTAVLAERLFRRaLRPDP-SHHAPTLVWRPG 77  Rhesus monkey
XP_005323904   1 MPATRGQPSEHMEA--PSASETALWPPLPCGPCIPIMLALASLAAFFILTTAVLAERLFRRsLRADPgTHHAPTLVWRPG 78  thirteen-lined ...
XP_005007632  18 MPSTSTRLTGHMEG--PPATEATFWPPLPCGPCIPILLALASLAAFFILTTAVLAERLFRRsLHPDP-SHRVPTLVWRPG 94  domestic guinea...
XP_004773952   1 MPSTPEQPFGHTGG--LPVPEMGSWPPLPCGPCIPIMLALASLAALFLLSTAVLAERLFRRsQHADP-SHHAPTLVWRPG 77  domestic ferret
Q5BK39        79 GELWIEPTSSARERSEDWYGSSIPLLMDRAPDPPTPGGTLEGRATAppaIPTPH------PSPSSLVPQTPPEVPAqSTF 152 Norway rat
XP_001367996  78 GELWIEPVGTPHERSEDWYGAIAPLLHSQVTEATIPRGTLEAQATA---PPNPD------SPPCPSVLPWAPESPG-STF 147 gray short-tail...
XP_001501645  78 GELWIEPTGTPRERSEDWYGSAVPLLRDQAPDPPTPGGTLEARATAppaSSAPH------SPPRSLVPQTPPKVLAhSTF 151 horse
XP_003418898  78 GELWIEPTGTPRERSEDWYGSAVPLLMDGAPEALNPGGTLEARATApsaPSAPH------SPPSSLVFQAPPQVPArSTF 151 African savanna...
NP_001181186  78 GELWIEPMGTPRERSEDWYGSAVPLLTDRAPEPPTPVGVLEAQATApyaPSAPN------SAPSSLGPQTSPEVPArSTF 151 Rhesus monkey
XP_005323904  79 GELWIEPTGTARERSEDWYGAAVPLLSGRAPDPPTPGGTLEAQASAplaPLAPH------SAPSSLVLQTPPEVPAqSTF 152 thirteen-lined ...
XP_005007632  95 GELWIEPAGTARERSEDWYGCEEPLLTDRSPDFPPPGGTLEARASAppaPSALH------SSPSSSVPQEHPNILAqSTF 168 domestic guinea...
XP_004773952  78 GELWIEPRGTPRERSEDWYGSAVPLLMDRAPDPPTPGGTLEARATAppaPSAPPtplaplTPPSSLGPHTPPRAPVrSTF 157 domestic ferret
Q5BK39       153 WRPQTQEESPYATGLVSWVGPEPMAEAgleVGSPRAWRLRQGSLEPDWSLQPRVTLEQISAFWKREGRTSVG 224 Norway rat
XP_001367996 148 WMANPWEERPRTTGLVGWCEPQPGPEP---LSSPFYGSHRPGSPEPDWGLQPRVTLEQISAFWRRENRVGGG 216 gray short-tailed opossum
XP_001501645 152 WGPQVGEERPHAPGLVSWAEPEQGPVAsvyLGSPQSRRQRPGSPDPEWGLQPRVTLEQISAFWRREGRTSVG 223 horse
XP_003418898 152 CVPQPWEERSHNTGMVSWAEPEPRPGDsvyLGSPRAQRHRPGSPEPGWGLQPLVTLEQISAFWRREGRTSVG 223 African savanna elephant
NP_001181186 152 WGPQPWEGRPPGTGLVSWAEPEQRPEAraqFGSPQARRQRPRSPDPEWGLQPRVTLEQISAFWRREGRTSVG 223 Rhesus monkey
XP_005323904 153 WGPQPQEERPHATGLVSWAEPELRSEVsmqLGSPKAWRQRPGSPEPDWGLQPRVTLEQISAFWRREGRTSVG 224 thirteen-lined ground s...
XP_005007632 169 WGPQPCGERPPTTGLVSWVGPELRPEAtpmLGSATAWRPRPGSPEPDWSLQPRVTLEQIAAFWRREGRTSVS 240 domestic guinea pig
XP_004773952 158 WGPQALNERPCAPGLVSWAEPEHRPEAtvhLGSPQAQRQQLGSPDLEWGPQPRVTLEQISAFWRRESRTSVG 229 domestic ferret
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap