3ZNV


Conserved Protein Domain Family
Peptidase_C101

?
pfam16218: Peptidase_C101 
Click on image for an interactive view with Cn3D
Peptidase family C101
This is a family of cysteine-peptidases that is conserved in vertebrates. The key residues as found in human OTULIN are Asp126, Cys129, His339 and Asn341.
Statistics
?
PSSM-Id: 318458
View PSSM: pfam16218
Aligned: 18 rows
Threshold Bit Score: 427.885
Threshold Setting Gi: 405975837
Created: 29-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3ZNV_A         4 SVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMllpEK 83  human
XP_008107068 212 SVESEVDIMDYCRKEWRGNTAQAKCIRKGYEAVSQRFISIRRVRGDNYCAVRATLFQALSQATQLPDWLQREEIImlpQK 291 green anole
XP_003204869 113 SVAPEMDILEYCEKEWRGNTPVARRMRKGYEAVAQKFASIRQVRGDNYCALRATLFQALSQATQLPRWMQSEDFTmlpEN 192 turkey
XP_002815487  81 SVAPEMDIMDYCKKEWRGNTQKATCMKKGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELTllpEK 160 Sumatran orangutan
NP_001159487 121 SVSAAEDLQTYSEKEWRGNTTKSQLIRKGYEAIASEF-RLCRVRGDNYCALRATLFQVLSQSKKLPAWLQDSDIVkwpKE 199 zebrafish
XP_001341618 579 SLASAVDILAYSEREWKGSTDKSARIRKGYSEMSHSFSGLRRVRGDNYCALRATLYQVLATSTNMPTWMQDESFLllpES 658 zebrafish
XP_005798659 302 SLSPAVDILSYSEREWKGNTAKSALIRKGYKEMSAKFSHLRRVRGDNYCALRATLFQVLSQSVQVPQWLQDDTVLmlpKQ 381 southern platyfish
XP_011606344 116 SLAPAMDILSYSEREWRGNTAKSALIRKGYTEMSSRFSSLRRVRGDNYCALRATLFQVFTHSTQLPSWLQDEDVAmlpDQ 195 torafugu
XP_010749774 459 SLAPAMDILSYSEREWKGNTAKSALIRKGYKEMSQRFGRLRRVRGDNYCALRATLFQVLSHSTQLPVWLQEEDITmlpKQ 538 large yellow cr...
XP_005449043 395 SLSPAVNILLYSEREWKGNTPKSALIKKGYKEMSQSFASVRRVRGDNYCALRATLFQVLSHSTQLPTWLQNEDVImlpKQ 474 Nile tilapia
3ZNV_A        84 LISKYNWIKQWKLGLKF--DGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLN 161 human
XP_008107068 292 LTIKYDWIGQWQLRQKA--TNNVENLVVEIEECLMLLKRKWKNMTELKTLAERQAACDELFRSEDDEYKLYEAVKFLMLN 369 green anole
XP_003204869 193 LLSKYDWIKQWQLKQNP--SRKTGEISDEIKEYLLLLKKKWKCVSDIKCSVEKQEACDELFKNEEEEYSLYEALKFLMLN 270 turkey
XP_002815487 161 LISKYNWIKQWKLGLKF--DGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEEEEYSLYEAVKFLMLN 238 Sumatran orangutan
NP_001159487 200 LHSDENFLKEWQFPLE-----SKKNNVQHLEQCLDLLKKKWQEAVQCKSLAERERMSQQVFRGLNEEYELLEALKFLMLR 274 zebrafish
XP_001341618 659 IETREHLIGGWVFPPQCk-LGSEENSVEKLKYYLGLLKTQWRAAVACESPEEKQSLCEHVFQGGDEEYGLLEALKFLMLA 737 zebrafish
XP_005798659 382 LKAQEGLISQWRFPGQHapGDGAGDPTERLKGYMELLRKTWQAAAERPGSAERQQLCERLFQGEEEELGMLEALKLLMLG 461 southern platyfish
XP_011606344 196 LEAQEGLISGWSFPGEClqGDGRGDAILQMKGYTKLLRAKWQAAVDCPSVAERQRLCERLFQGGEEELGLLEALKLLMLA 275 torafugu
XP_010749774 539 LEAQEGLISHWTFPGDClqGDGTGDAALQLKGYMELLRNKWQAAVDCSSAAERQQQCERVFQGGEDELGLLEALKLLMLG 618 large yellow cr...
XP_005449043 475 LEAQDGLISQWTFPGVClqRDGTGDAVQQLKGYMELLRNTWQAAVDCATDAERQQLCEQVFQGGEDELGLLEALKLLMLS 554 Nile tilapia
3ZNV_A       162 RAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITV 241 human
XP_008107068 370 TAIRLYEDNEKGKEVPVFAWLLFARDTSSNPSQLMENHLNQLGHTGGLEQVEMFLLAYALQHTIQVYRLYKYSTDEFIAF 449 green anole
XP_003204869 271 TAIQLYNDEKNGRRVPVFSWLLFARDTSSNPCQLMHNHLNQIGHSGGLEQVEMFLLAYALQYTIQVYRLYKCSTDEFITF 350 turkey
XP_002815487 239 RAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITV 318 Sumatran orangutan
NP_001159487 275 TAAQLHLNMEKGSDVPEFCWLLFARDSSKCPKTFLTNHLRHVGFSGGLEQVEMCLLGHSLQQTIKVFRLYKCDTEEFITY 354 zebrafish
XP_001341618 738 KAIELHRKMVTDQEVPVFCWLLFARDTSENPQSLLANHLSQIGFSGGVEQVEMFLLGYALNYTIQAFRLYMTDTEEFVTH 817 zebrafish
XP_005798659 462 RAAELHGHMQAGQDVPLFCWLLFARDSSDCPRSFLSNHLRHVGLSAGLEQVEMFLLGYALQHTIQVYRLYKANTEEFVTF 541 southern platyfish
XP_011606344 276 RALELHGRMQAEGDVPLFCWLLFARDSSDCPRSFLSNHLSHVGLSAGLEQVEMFLLGYTLECTIQVYRLYKADTEEFVTF 355 torafugu
XP_010749774 619 RAVELHGCMQAGGDVPLFCWLLFARDSSDCPRSFLSNHLSHVGLSAGLEQVEMFLLGYALQCTIQVYRLYKADTEEFVTY 698 large yellow cr...
XP_005449043 555 RAAELHSCMQGGEDVPLFCWLLFARDSSDCPRSFLSNHLSHVGLTAGLEQVEMFLLGYALQCTIQVYRLYKADTEEFVTY 634 Nile tilapia
3ZNV_A       242 YPTDPPKDWPVVTLIAEDDRHYNIPV 267 human
XP_008107068 450 YPNEPEEHWPVVTLITEDDRHYNIPa 475 green anole
XP_003204869 351 YPNDPEEDWPVVTLITEDDRHYNILV 376 turkey
XP_002815487 319 YPTDPPKDWPVVTLIAEDDRHYNIPV 344 Sumatran orangutan
NP_001159487 355 YPNDHKNDWPHLVLLTEDDRHYNALI 380 zebrafish
XP_001341618 818 YPDDHKHEWPCVCIVTEDDRHYNVPV 843 zebrafish
XP_005798659 542 YPDDHLDDWPSVCLVTEDDRHYNVPV 567 southern platyfish
XP_011606344 356 YPDDHRDDWPSVCLVTEDDRHYNVPI 381 torafugu
XP_010749774 699 YPDDHKDDWPSVCLVTEDDRHYNVPV 724 large yellow croaker
XP_005449043 635 YPDDHRDDWESVCLVTEDDRHYNVPV 660 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap