Conserved Protein Domain Family
Sm_like

?
pfam16243: Sm_like 
Sm_like domain
This domain, approximately 150 residues, is mainly found in several uncharacterized proteins in various Prochlorococcus and Synechococcus species. The crystal structure of ECX21941 reveals unexpected similarity to Sm/LSm proteins, which are important RNA-binding proteins, despite no detectable sequence similarity. The specific function of this family is unknown, but the structure analysis of ECX21941 indicates nucleic acid-binding capabilities and suggests a role in RNA and/or DNA processing.
Statistics
?
PSSM-Id: 318477
View PSSM: pfam16243
Aligned: 10 rows
Threshold Bit Score: 130.209
Threshold Setting Gi: 418487283
Created: 30-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0QZ83        14 IFKLNNGEEVVGKAVLTDDQGETLVFISNPVVIETYTRELDSGKISRGMGFSHWMQMSDEEFFILREKDIIALGTLQPEY 93  Synechococcus p...
Q58LI1        19 VLKLVSGEEVLGKAVLTNEGNETLCFIQNPIAVQMVERELDGDRLARGIGFSKWMQLSDEDFYVIREKDILTISAMSKQC 98  Prochlorococcus...
YP_004323036  14 IFKLVSGEEILAKAVLTDDNGETLCFISDPVMIQTITKEIDDTKVLRGMGFTKWMPMSDEEFYILREKDIMTIASMSSPV 93  Synechococcus p...
YP_007001842  14 IFKLVNGEDVLGKSLITEDNGESIVFIQDPVTLEIFTKDLDDGKVARGMGFAKWMQMSDEEFFMQREKDIISLATMSKET 93  Synechococcus p...
YP_007518208  14 VIKLTNGEEILAKAVLTEDEGETLIFVSSPVLIQNVMKELPDGKVLKAMGFARWMQMSDEDFFILREKDIITIASMSREV 93  Synechococcus p...
YP_004324740  14 IFKLVSGEEILAKAVLTEDKGESLIFISDPVSVQAITKEIGNEKVVRGMGFTKWIPMSEEDFYILREKDIMTIATMSKPI 93  Synechococcus p...
YP_004323963  14 IFKLVNGEEVLGKAILTQDETETLVFIQDPVCVQVVTRESEDGKVTRGMGFTKWMQLSEEDFYIIREKDIITVSSMSKEV 93  Synechococcus p...
YP_008125650  14 IFKLLNGEEVLGKAVLTEDEGQTLVFIQDPVCTQIVTKETDDGKTIRGMGFAKWMQLSDEDFFILQEKDILTVTSMSKEI 93  Synechococcus p...
AHB80749      14 IFKLVNGEDVLGKSLITEDNGESIVFIQDPVTLEIFTKDLDDGKVARGMGFAKWMQMSDEEFFILREKDIISLATMSKET 93  Synechococcus p...
YP_007001631  14 IFKMTNGEEVLSRAVITVDQNESLIFLQDPVMVHVMTKPMSETKMVRGVGFVKWQQLSDEEFFVVKVKDVVCIATMSREV 93  Synechococcus p...
Q0QZ83        94 VIMYE 98  Synechococcus phage syn9
Q58LI1        99 IFMYE 103 Prochlorococcus phage P-SSM4
YP_004323036  94 VLMYE 98  Synechococcus phage S-SM1
YP_007001842  94 IFLYE 98  Synechococcus phage S-MbCM6
YP_007518208  94 MFMYE 98  Synechococcus phage S-RIM8 A.HR1
YP_004324740  94 VLMYE 98  Synechococcus phage S-SSM5
YP_004323963  94 IFMYE 98  Synechococcus phage Syn19
YP_008125650  94 SYLYE 98  Synechococcus phage S-CAM8
AHB80749      94 IFLYE 98  Synechococcus phage S-MbCM25
YP_007001631  94 QLLYE 98  Synechococcus phage metaG-MbCM1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap