Conserved Protein Domain Family
SSF

?
pfam00474: SSF 
Sodium:solute symporter family.
Statistics
?
PSSM-Id: 109527
View PSSM: pfam00474
Aligned: 10 rows
Threshold Bit Score: 397.481
Threshold Setting Gi: 239938811
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 400353     39 YFLAGRSMTWVAIGASLFVSNIGSEHFIGLAGSGAASGFAVGAWEFNALLLLQLLGWVFIPIYI-----RSGVYTMPEYL 113
gi 400322     58 FFLAGRDVTWWPMGASLFASNIGSGHFVGLAGTGAASGIAIAAFEWNALLLLLVLGWFFVPIYI-----KAGVMTMPEYL 132
gi 127803     58 FFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYI-----KAGVVTMPEYL 132
gi 1172008    36 YFLGSRSMGGIVLAMTLTATYISASSFIGGPGAAYKYGLGWVLLAMIQLPAVWLSLGILGKKFAil-arRYNAVTLNDML 114
gi 1172009    36 YYVGNRSMTGFVLAMTTASTYASASSFVGGPGAAYKYGLGWVLLAMIQVPVVWLALGALGKKFAll-srETNALTINDLF 114
gi 1172774    35 YILGGRRLGSFVTAMSAGASDMSGWLLMGLPGAVYLSGLVEGWIAIGLTIGAYFNWLLVAGRLRvytelNNNALTLPEYF 114
gi 131658     35 YILGGRSLGPFVTALSAGASDMSGWLLMGLPGAVFLSGISESWIAIGLTLGAWINWKLVAGRLRvhteyNNNALTLPDYF 114
gi 239938811  33 FYTAGGGLTGVQNGLAIAGDYMSAASFLGIAGMIALYGFDGFFYSIGFLVAYLVVLYIVAEPLR-----NLGKYTMADMI 107
gi 418555     63 YYTAGGNITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSLGFLVGWPIILFLIAERLR-----NLGRYTFADVA 137
gi 400337     55 YFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYL-----TAGVITMPQYL 129
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 400353    114 SKRFGGHR-IQVYFAALSLILYIFTKLSVDLYSGALFIQESLGWNLYVSVILLIGMTALLTVTGGLVAVIYTDTLQALLM 192
gi 400322    133 RKRFGGKR-LQIYLSILSLFICVALRISSDIFSGAIFIKLALGLDLYLAIFSLLAITAIYTITGGLASVIYTDTLQTIIM 211
gi 127803    133 RKRFGGQR-IQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVIM 211
gi 1172008   115 FARYQSRL--LVWLASLSLLVAFVGAMTVQFIGGARLLETAAGIPYETGLLIFGISIALYTAFGGFRASVLNDTMQGLVM 192
gi 1172009   115 FYRYKNKY--LVWLSSLALLLAFFAAMTVQFIGGARLLETTIGISYTQALLLFALTVGIYTFIGGFRAVVLTDTIQGTVM 192
gi 1172774   115 HNRFGSSHkLLKLVSATIILVFLTIYCASGVVAGAKLFQNIFSVEYSTALWYGAAATIAYTFIGGFLAVSWTDTIQATLM 194
gi 131658    115 TGRFEDKSrILRIISALVILLFFTIYCASGIVAGARLFESTFGMSYETALWAGAAATILYTFIGGFLAVSWTDTVQASLM 194
gi 239938811 108 AARFKEKK--IRGVAALNTIAISTFYMIAQLVGAGALIKLLLGLDYTAAVLIVGVLMTIYVVFGGMIATSWVQIIKAVLL 185
gi 418555    138 SYRLKQGP--IRILSACGSLVVVALYLIAQMVGAGKLIELLFGLNYHIAVVLVGVLMMMYVLFGGMLATTWVQIIKAVLL 215
gi 400337    130 RKRFGGRR-IRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYTDTVQTFVI 208
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 400353    193 IVGALTLMIISMMEIG--GFEEVKRRYMLASPNVtsILLtynlsntnscNVhpkKDALKMLRNPTDEDVPWPGFVLGQTP 270
gi 400322    212 LIGSFILMGFAFVEVG--GYESFTEKYMNAIPTIveGDNltis---pkcYTp-qGDSFHIFRDAVTGDIPWPGMIFGMTV 285
gi 127803    212 LVGSLILTGFAFHEVG--GYDAFMEKYMKAIPTIvsDGNttfq---ekcYTp-rADSFHIFRDPLTGDLPWPGFIFGMSI 285
gi 1172008   193 LIGTVVLLIGVVHAAG--GLSNAVQTLQTIDP-----QL----------VT---PQGADDILSPAFMTSFWVLVCFGVIG 252
gi 1172009   193 IFGTIILLIGTIYALG--GVESAVNKLTEIDP-----DL----------VT---PYGPNGMLDFQFMASFWILVCFGVVG 252
gi 1172774   195 IFALILTPVFVLLSFAdtAQFSAVLEQAEAAVNKdfTDL----------FT---STT------PLGLLSL-AAWGLGYFG 254
gi 131658    195 IFALILTPVIVIISVGgfGDSLEVIKQKSIEN----VDM----------LK---GLN------FVAIISL-MGWGLGYFG 250
gi 239938811 186 MAGTLVISIIVFSKFGf-SLNTMFEQMKTATPLG--ADF----------LN---PGNK--YKVPLETLSLNLALVLGTAG 247
gi 418555    216 LFGASFMAFMVMKHVGf-SFNNLFSEAMAVHPKG--VDI----------MK---PGGL--VKDPISALSLGLGLMFGTAG 277
gi 400337    209 LGGACILMGYAFHEVG--GYSGLFDKYLGAATSLtvSEDpavgnissfcYRp-rPDSYHLLRHPVTGDLPWPALLLGLTI 285
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 400353    271 AsvwywcadQVIVQRVLAAKniahaKGSTLMAGFLKLLPMFIIVVPGMISRILFADDIACINPehcmQVCGSRAGCSNIA 350
gi 400322    286 VaawywctdQVIVQRCLSGKdmshvKAACIMCGYLKLLPMFLMVMPGMISRILYTEKVACVVPsecvKHCGTEVGCSNYA 365
gi 127803    286 LtlwywctdQVIVQRCLSAKnmshvKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPseceKYCGTKVGCTNIA 365
gi 1172008   253 L--------PHTAVRCISYK-----DSKAVHRGIIIGTIVVAILMFG--------MHLAGALG----RAVIPDLTVPDLV 307
gi 1172009   253 L--------PHTAVRCMAFK-----DSKALHRGMLIGTIVLSIIMLG--------MHLAGALG----RAVIPNLTVSDQV 307
gi 1172774   255 Q--------PHILARFMAAD-----SVKSLIKARRISMGWMVLCLAGAIGIGLFAIPYFFANP----AIAGTVNREPEQV 317
gi 131658    251 Q--------PHILARFMAAD-----SHHSIVHARRISMTWMILCLAGAVAVGFFGIAYFNDHP----ALAGAVNQNAERV 313
gi 239938811 248 L--------PHILIRFYTVK-----DAKTARTSVVSATWIIGVFYIMTVFLGFGAAAFVGF------DAITAADQAGNMA 308
gi 418555    278 L--------PHILMRFFTVS-----DAREARKSVFYATGFMGYFYILTFIIGFGAIMLVGANPey-kDAAGHLIGGNNMA 343
gi 400337    286 VsgwywcsdQVIVQRCLAGKslthiKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPevcrRVCGTEVGCSNIA 365
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 400353    351 YPRLVMKLVPVGLRGLMMAVMIAALMSDLDSIFNSASTIFTLDVYKLIRRSASSRELMIVGRIFVAFMVVISIAWVPIIV 430
gi 400322    366 YPLLVMELMPSGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDLYTKIRKQASEKELLIAGRLFIILLIVISIVWVPLVQ 445
gi 127803    366 YPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQ 445
gi 1172008   308 IPTLMVKVLPPFAAGIFLAAPMAAIMSTINAQLLQSSATIIKDLYLNIRPDQMQNETRLKRMSAVITLVLGALLLLAAWK 387
gi 1172009   308 IPTLMIKVLPPIVAGIFLAAPMSAIMSTIDAQLIQSSSIFVKDLYLSAKPEAAKNEKKVSYFSSIITLILTALLIFAALN 387
gi 1172774   318 FIELAKLLFNPWIAGILLSAILAAVMSTLSAQLLISSSSITEDFYKGFIRPN-ASEKELVWLGRIMVLVIAALAIWIAQD 396
gi 131658    314 FIELAQILFNPWIAGILLSAILAAVMSTLSCQLLVCSSAITEDLYKAFLRKH-ASQKELVWVGRVMVLVVALVAIALAAN 392
gi 239938811 309 APLLAKALGGDFLFAFVSAIAFATILAVVTGLVLSAASAFAHDIYSQIIRKGEATEKEQMKAARWASVAVSVLSILLAIF 388
gi 418555    344 AVHLANAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVFKKG-ATEREELRVSKITVLILGVIAIILGVL 422
gi 400337    366 YPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDRELLLVGRLWVVFIVVVSVAWLPVVQ 445
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*..
gi 400353    431 EMQGGqMYLYIQEVADYLTPPVAALFLLAIFWKRCNEQGAFYGGMAG 477
gi 400322    446 VAQNGqLFHYIESISSYLGPPIAAVFLLAIFCKRVNEQGAFWGLIIG 492
gi 127803    446 SAQSGqLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILG 492
gi 1172008   388 PPEM--IIWLNLLAFGGLEAVFLWPLVLGLYWERANAKGALSAMIVG 432
gi 1172009   388 PPDM--IIWLNLFAFGGLEAAFLWVIVLGIYWDKANAYGALSSMIIG 432
gi 1172774   397 ENSK--VLKLVEFAWAGFGSAFGPVVLFSLFWKRMTSSGAMAGMLVG 441
gi 131658    393 PENR--VLGLVSYAWAGFGAAFGPVVLFSVMWSRMTRNGALAGMIIG 437
gi 239938811 389 AQSLN-VAFLVALAFAVAASANLPLIVFTVFWKRFNASGALWGSLTG 434
gi 418555    423 FENQN-IAFMVGLAFAIAASCNFPIILLSMYWSKLTTRGAMMGGWLG 468
gi 400337    446 AAQGGqLFDYIQAVSSYLAPPVSAVFVLALFVPRVNEQGAFWGLIGG 492
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap