Conserved Protein Domain Family
X

?
pfam00739: X 
Trans-activation protein X
This protein is found in hepadnaviruses where it is indispensable for replication.
Statistics
?
PSSM-Id: 109783
View PSSM: pfam00739
Aligned: 5 rows
Threshold Bit Score: 195.946
Threshold Setting Gi: 139897
Created: 13-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75564793   1 MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHGAHLSLRGLPVCAFSPAGPCALRFTSA--RR 78
gi 75561922   1 MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVSTDHGAHLSLRGLPVCAFSCAGPCALRFTSA--RR 78
gi 75564930   1 MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAYLSLRGLPVCAFSSAGPCALRFTSA--RR 78
gi 139897     1 MAARLCCQLDPARDVLLLRPFGSQSSGPPFPRPSAGSAASPASSLSASDESDLPLGRLPACFASASGPCCLVVTCAelRT 80
gi 139887     1 MAARLCCQLDSSRDVLLLRPLRGQPSGPSVSGTSAGSPSSAASAFSSGHQADIPVGRLPACFYSSAGPCCLGFTCAdlRT 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 75564793  79 METTVNDHRNLSKVLHKRTLGLSAMSTTDL-EAYFKDCVFTEWEELGEEMRLMIFVLGGCRHKLV 142
gi 75561922  79 METTVNAHRILSKDLRTMTLELSGLSTSDL-EAYFKDRVFTEWEELGEEIRLMIFVLGGCTHTLL 142
gi 75564930  79 METTVNAHQVLPKVLHKRTLGLSAMSTTDL-EAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLV 142
gi 139897    81 MDSTVN----FVSWHANRQLG---MPSKDLwTPYIRDQLLTKWEEGSIDPRLSIFVLGGCRHKCM 138
gi 139887    81 MDSTVN----FVPWHAKRQLG---MMQKDFwTAYIRDQLLTLWEEGIIDPRLKLFVLGGCRHKYM 138
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap