Conserved Protein Domain Family
FMO-like

?
pfam00743: FMO-like 
Flavin-binding monooxygenase-like
This family includes FMO proteins, cyclohexanone mono-oxygenase and a number of different mono-oxygenases.
Statistics
?
PSSM-Id: 109787
View PSSM: pfam00743
Aligned: 5 rows
Threshold Bit Score: 1028.6
Threshold Setting Gi: 6166183
Created: 12-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544324    2 AKKVAVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGLWRFKENVEDGRASIYKSVITNTSKEMSCFSDFPMPEDFPNF 81
gi 1346020   3 KKRIAVIGGGVSGLSSIKCCLEEGLEPVCFERSADIGGLWRFQENPEEGRASIYKSVIINTSKEMMCFSDYPIPDHYPNF 82
gi 399506    2 AKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVTNVCKEMSCYSDFPFHEDYPNF 81
gi 6166183   2 GKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFPDFPFPDDFPNF 81
gi 399505    2 AKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVSNSCKEMSCYSDFPFPEDYPNY 81
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544324   82 LHNSKLLEYFRLFAKKFDLLKYIQFQTTVLTVKKHPDFSSSGQWEVVTQSDGKEQSAVFDAVMVCSGHHILPHIPLKSFP 161
gi 1346020  83 MHNSHVLEYFRMYAKEFGLLKYIQFKTTVCNVKKRPDFSTSGQWEVVTEHEGKTKVDVFDAVMVCTGHHTNAHLPLESFP 162
gi 399506   82 MNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFSETGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAFP 161
gi 6166183  82 MHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFP 161
gi 399505   82 VPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFP 161
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544324  162 GIERFKGQYFHSRQYKHPAGFEGKRILVIGIGNSASDIASELSKNAAQVFISTRNGSWVMSRISEDGYPWDMVFHTRFKS 241
gi 1346020 163 GIEKFKGQYFHSRDYKNPEAFTGKRVVIIGIGNSGGDLAVEISHTAKQVFLSTRRGSWILNRVGKHGYPTDVLLSSRFTY 242
gi 399506  162 GIHKFKGQILHSQEYKIPEGFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCCS 241
gi 6166183 162 GLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFGT 241
gi 399505  162 GINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQN 241
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544324  242 MLRNILPRTVSKWMMEQQLNRWFNHANYSLEPKNKYLMKEPILNDDLPSRILYGAVKVKSRVTQLTETSALFEDGTVEED 321
gi 1346020 243 FLSKILGQSLSNAYVEKQMNERFDHEMFGLKPKHRAMSQHPTVNDDLPNRIIAGMVKVKGNVKEFTETAAIFEDGSREDD 322
gi 399506  242 FIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAK-FIVNDELPNCILCGAITMKTSVIEFTETSAVFEDGTVEEN 320
gi 6166183 242 FLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEG 321
gi 399505  242 MLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEP 321
                      330       340       350       360       370       380       390       400
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544324  322 IDVIVFATGYTFSFPFLEESlVKIEHNMVSLYKYMFPPQLEKPTLTCMGLIQPLGSIFPTVELQARWATRVFKGLCHLPS 401
gi 1346020 323 IDAVIFATGYSFDFPFLEDS-VKVVKNKVSLYKKVFPPNLERPTLAIIGLIQPLGAIMPISELQGRWAVQVFKGLKTLPS 401
gi 399506  321 IDVVIFTTGYTFSFPFFEEPlKSLCTKKIFLYKQVFPLNLERATLAIIGLIGLKGSILSGTELQARWVTRVFKGLCKIPP 400
gi 6166183 322 IDCVIFATGYSFAYPFLDESiIKSRNNEIILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPS 401
gi 399505  322 IDIIVFATGYTFAFPFLDESvVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPP 401
                      410       420       430       440       450       460       470       480
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 544324  402 EKTMMEDIIKRNEKRIDLFGESQSQIVQTNYVDYLDELALEIGAKPDLISFLLKDPELAVKLCFGPCNSYQYRLVGPGQW 481
gi 1346020 402 QSEMMAEITKAQEEIAKRYVDSQRHTIQGDYIQTMEEIAEFVGVKPNLLSLAFTDPKLALKLFFGPCTPIHYRLQGPGKW 481
gi 399506  401 SQKLMMEATEK-EQLIKRGVFKDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKW 479
gi 6166183 402 MEDMMNDINEKMEKKRKWFG--KSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQW 479
gi 399505  402 PSVMIEEINARKENKPSWFGLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKW 481
                      490       500       510       520       530
               ....*....|....*....|....*....|....*....|....*....|...
gi 544324  482 EGARRAILTQKQRILKPLKTRSVKAAPNLSASF-LMKILALVAVFVAFFSQLY 533
gi 1346020 482 HGARKAILTTYDRIRKPLNTRETEKSNSMVSAV-TTGCFMLAVVFFAIIMAYA 533
gi 399506  480 DGARNAILTQWDRTLKPLKTRIVPDSSKPASMShYLKAWGAPVLLASLLLICK 532
gi 6166183 480 PGARNAILTQWDRSLKPMQTRVVGRLQKPCFFFhWLKLFAIPILLIAVFLVLT 532
gi 399505  482 EGARNAIMTQWDRTFKVIKARVVQESPSPFESF--LKVFSFLALLVAIFLIFL 532
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap