Conserved Protein Domain Family
HCV_NS4b

?
pfam01001: HCV_NS4b 
Hepatitis C virus non-structural protein NS4b
No precise function has been assigned to NS4b. However, it is known that NS4b interacts with NS4a and NS3 to form a large replicase complex to direct the viral RNA replication.
Statistics
?
PSSM-Id: 110032
View PSSM: pfam01001
Aligned: 11 rows
Threshold Bit Score: 201.835
Threshold Setting Gi: 81919863
Created: 12-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 68565638 1616 ASFIPLEAMVAAIDKLKSTITTTSPftletALEKLNTFLGPHAATILAIIEYCCGLVTLPDNPFASCVFAFIAGITTPLP 1695
gi 81921385 1729 FKEKVLGLIGTAGQKAETLKPAATS-----MWSKAEQFWAKHMWNFVSGIQYLAGLSTLPGNPAVATLMSFTAAVTSPLT 1803
gi 81924656 1734 FKEKVLGLLQRATQQQAVIEPIVAT-----NWQKLEAFWHKHMWNFVSGIQYLAGLSTLPGNPAVASLMAFTASVTSPLT 1808
gi 130461   1728 FKQKALGLLQTASRHAEVITPAVQT-----NWQKLEVFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLT 1802
gi 81921384 1732 FRQKVLGLLQASAKQAEELKPAVHS-----AWPRVEDFWRKHMWNFVSGIQYLAGLSTLPGNPAVASLMSFTASLTSPLR 1806
gi 81919863 1713 QAKTAEAYTATAKWLAGCYTGTRAVptvsiVDKLFAGGWAAVVGHCHSVIAAAVAAYGASRSPPLAAAASYLMGLGVGGN 1792
gi 81922317 1723 RSFCANNYCPPGGG-ATSASAFFAS-----LDTKFAQAWDAIFTNGRSLLVGLVAGYGARRNPPLGVAAAFLMGMSAGHQ 1796
gi 81965057 1700 QAWAANNFVPPP---ASHSTSLLQS-----LDAAFTSAWDSVFTHGRSLLVGFTAAYGARRNPPLGVGASFLLGMSSSHL 1771
gi 81922316 1710 QAWSSGMFVPPPAASAEHMPSIIQS-----LDTAFTRAWDTVFTHGRSLLVGFTAAYGAKRNPPLGVGASFLLGMSAGHS 1784
gi 81921784 1702 KAWTAGVLVPPAPALADNAPGLLAT-----LDTMFTQTWEAIFTNGRSLLVGXTAAYGAKRNPPLGVAASFLLGMSAGRA 1776
gi 130468   1732 LKSKIQGLLQQATRQAQDIQPAIQS-----SWPKLEQFWAKHMWNFISGIQYLAGLSTLPGNPAVASMMAFSAALTSPLP 1806
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 68565638 1696 HKIKMFLSLFGGAIASKLTDARGALAFMMAGAAGTALGTWTSVGFVFDMLGGYAAASSTACLTFKCLMGEWPTMDQLAGL 1775
gi 81921385 1804 THQTLLFNILGGWVASQIAPPTAATAFVVSGMAGAAVGNIGLGRVLIDILAGYGTGVAGALVAFKIMCGERPTAEELVNL 1883
gi 81924656 1809 TNQTMFFNILGGWVATHLAGPQSSSAFVVSGLAGAAIGGIGLGRVLLDILAGYGAGVSGALVAFKIMGGELPTAEDMVNL 1888
gi 130461   1803 TGQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAALDSVGLGKVLVDILAGYGAGVAGALVAFKIMSGEVPSTEDLVNL 1882
gi 81921384 1807 TSQTLLLNILGGWIAAQVAPPPASTAFVVSGLAGAAVGSIRLGRVLVDVLAGYGAGVSGALVAFKIMSGECPSTEDMVNL 1886
gi 81919863 1793 AQTRLASALLLGAAGTALGTPVVGLTMAGAFMGGASVSPSLVT-ILLGAVGGWEGVVNAASLVFDFMAGKLS-SEDLWYA 1870
gi 81922317 1797 VHVRLAAALLLGVGGTMLGTPSVGLAMSGAYFAGGSITSSWLS-AIVAVLGGWEGAXNAASLTFDFLTGRAE-LKDMWFL 1874
gi 81965057 1772 THVRLAAALLLGVGGTVLGTPATGLAMAGAYFAGGSVTANWLS-IIVALIGGWEGAVNAASLTFDLLAGKLQ-ASDAWCL 1849
gi 81922316 1785 VHVRLAAALLLGVGGTMLGQASTGLAMAGAYFAGGSITSSWLS-VIVALLGGWEGAVNAASLTFDLLSGRAE-AKDAWCI 1862
gi 81921784 1777 VHVRLAAALLLGVGGTMLGQASTGLAMAGAYFAGGSITSSWLS-IIITLLGGWEGAVNAASLTFDLLSGKAE-AKDAWCI 1854
gi 130468   1807 TSTTILLNIMGGWLASQIAPPAGATGFVVSGLVGAAVGSIGLGKILVDVLAGYGAGISGALVAFKIMSGEKPTVEDVVNL 1886
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 68565638 1776 VYSAFNPAAGVVGVLSACAMFALTT--AGPDHWPNRLLT 1812
gi 81921385 1884 LPSILCPGALVVGVICAAVLRRHIGpgEGAVQWMNRLIA 1922
gi 81924656 1889 LPAILSPGALVVGVICAAILRRHVGpgEGAVQWMNRLIA 1927
gi 130461   1883 LPAILSPGALAVGVVFASILRRRVGpgEGAVQWMNRLIA 1921
gi 81921384 1887 LPALLSPGVALVGVVCAAILRRHVGpaEGANQWMNRLIA 1925
gi 81919863 1871 IPVLTSPGAGLAGIALGLVLYSANN--SGTTTWLNRLLT 1907
gi 81922317 1875 VSCXASPGASVAGVALGLLLWSMKK--GVGEDWVNRILT 1911
gi 81965057 1850 VSCLASPGASVAGVALGLLLWSVKK--GVGQDWVNRLLT 1886
gi 81922316 1863 ISCLASPGASVAGAALGVLLWSMKK--GVGQDWVNRLLT 1899
gi 81921784 1855 ISCLASPGASVAGVALGVLLWSVKK--GVGHDWVNRLLT 1891
gi 130468   1887 LPAILSPGALVVGVICAAILRRHVGqgEGAVQWMNRLIA 1925
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap