Conserved Protein Domain Family
Lipoprotein_7

?
pfam01540: Lipoprotein_7 
Adhesin lipoprotein
This family consists of the p50 and variable adherence-associated antigen (Vaa) adhesins from Mycoplasma hominis. M. hominis is a mycoplasma associated with human urogenital diseases, pneumonia, and septic arthritis. An adhesin is a cell surface molecule that mediates adhesion to other cells or to the surrounding surface or substrate. The Vaa antigen is a 50-kDa surface lipoprotein that has four tandem repetitive DNA sequences encoding a periodic peptide structure, and is highly immunogenic in the human host. p50 is also a 50-kDa lipoprotein, having three repeats A,B and C, that may be a tetramer of 191-kDa in its native environment.
Statistics
?
PSSM-Id: 110537
View PSSM: pfam01540
Aligned: 3 rows
Threshold Bit Score: 456.854
Threshold Setting Gi: 75426518
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75426522   1 MKKSKKIFITLCGIATTAILPVATISCNDDKLAEKNGKEKADAALKQANALAEELKKNPDYSKILETLNKEIAEATKSFK 80
gi 75426518   1 MKKSKKIFITLCGIAATAILPVATISCNDDKLAEKNGKEKADAALKQANTLAEELKKNPDYAKILETLNKEIAEATKSFK 80
gi 75426519   1 MKKSKNIFITLCGIAATAILPVATISCNDDKLAEKNGKEKADAALKQANALVEELKKNPDYSKILETLNKEIAEATKSFK 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75426522  81 EAGSYGDYPAIISKLSAAVENAKSEQQKVDQANKKIAdenlkikegakellklsekiqsfadtialtitklegkkfeide 160
gi 75426518  81 EAGSYSDYPAIISKLSAAVENAKNEKKAIDDKNAQIA------------------------------------------- 117
gi 75426519  81 EAGSYGDYPAIISKLSAAVENAKNEKKAIDDKNAQIA------------------------------------------- 117
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75426522 161 tfkkqlistiellnkksvevktfatvntikkdfllselesfkefntswlekivseweevkkawskelaeikadddKKLAE 240
gi 75426518 118 ---------------------------------------------------------------------------KELAE 122
gi 75426519 118 ---------------------------------------------------------------------------KELAE 122
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75426522 241 ENQKIQNGIAELTKLSKENSDLAETIEETIAKLEKKFQIPKDFKEKLTSTIKLLNKKANEINTFVSTVSKKTEFVLEFLE 320
gi 75426518 123 RNAKIQSNIEELKKINNEAFELSKTVNKTIAEVEKKFKIDDKFKEQLENFADDLLDKSRQIDEFTTVTSTQEGFTLAELE 202
gi 75426519 123 RNAKIQSNIEELKKINNEAFELSKTVNKTIAEVEKKFKIEASFKEQLENFADDLLDKSRQIDEFTTVTSTQEGFTLAELE 202
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75426522 321 SFKELNTLQFNEIKTEWAKVQEAWKNELTEIN---SIIKGVEELKKLSHEISEFSNSVKKTISELEKKFKIDDTtnkeea 397
gi 75426518 203 SFKEITTTWFNGMKSEWARVLDAWKKEIEEINedkQIKSGIEELNKLNAEVENLKNEIEQTIEKVDKKFKIDDK------ 276
gi 75426519 203 SFKEITTTWFNGMKSEWARVLDAWKNELTEIN---SIIKGVEELKKLSHEISEFSNSVKKTISELEKKFKIDDKtnkdea 279
                       410       420       430       440       450       460       470
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 75426522 398 kkFKNELENFADQLLNKSHEIDKFVTVTSARGDFSLSELESFKSFNTTWFNEMKSEWARVQEAWKDQLKEISTK 471
gi 75426518 277 --FKKQLDLLVEDLLEKGRQIDEFTTVTAIQKDFNLLELETFKQFNTSWFKEVKAEWAKVLDAWKDQLKEISAK 348
gi 75426519 280 kqFKNELENFADQLLNKSHEIDKFVTVTSAREDFSLSELESFKSFNTTWFNEMKCEWARVQEAWKDQLKEISTK 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap