Conserved Protein Domain Family
HCV_NS1

?
pfam01560: HCV_NS1 
Hepatitis C virus non-structural protein E2/NS1
The hypervariable region of the E2/NS1 region of hepatitis C virus varies greatly between viral isolates. E2 is thought to encode a structurally unconstrained envelope protein.
Statistics
?
PSSM-Id: 110557
View PSSM: pfam01560
Aligned: 10 rows
Threshold Bit Score: 706.999
Threshold Setting Gi: 130465
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130468  386 YSSGQEAGRTVAGFAGLFTTGAKQNLYLINTNGSWHINRTALNCNDSLQTGFLASLFYTHKFNSSGCPERLSSCRGLDDF 465
gi 266820  386 YTTGGSQARHTQSVTSFFTQGPAQRIQLINTNGSWHINRTALNCNESLNTGFFAALFYAHKFNSSGCPERMASCSSIDKF 465
gi 130469  386 HVTGGRVASSTQSLVSWLSQGPSQKIQLVNTNGSWHINRTALNCNDSLQTGFIAALFYAHRFNASGCPERMASCRPIDEF 465
gi 266821  386 IVSGGTVARTTHSLASLFTQGASQKIQLINTNGSWHINRTALNCNDSLQTGFLASLFYAHRFNASGCPERMASCRSIDKF 465
gi 130458  386 HVTGGAQAKTTNRLVSMFASGPSQKIQLINTNGSWHINRTALNCNDSLQTGFLAALFYTHSFNSSGCPERMAQCRTIDKF 465
gi 130461  386 HVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDF 465
gi 130455  386 HVTGGSAGHTVSGFVSLLAPGAKQNVQLINTNGSWHLNSTALNCNDSLNTGWLAGLFYHHKFNSSGCPERLASCRPLTDF 465
gi 130467  386 QVTGGQAAHTVRGVASIFSPGSRQDISLINTNGSWHINRTALNCNDSLQTGFFAALFYVRRFNSSGCPERLSSCRKLDDF 465
gi 130465  386 RTVAGSAAATTRGFTSMFSSGSKQNLQLINTNGSWHINRTALNCNDSLNTGFIASLFYVNRFNSSGCPHRLSVCRSIEAF 465
gi 130466  386 HTVGGSTAHNARTLTGMFSLGARQKIQLINTNGSWHINRTALNCNDSLHTGFLASLFYTHSFNSSGCPERMSACRSIEAF 465
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130468  466 RIGWGTLEYETnvTNDGDMRPYCWHYPPRPCGIVPARTVCGPVYCFTPSPVVVGTTDKQGVPTYTWGENETDVFLLNSTR 545
gi 266820  466 AQGWGPITYTE--PRDLDQRPYCWHYAPRQCGIVPASQVCGPVYCFTPSPVVVGTTDRSGAPTYNWGANETDVLLLNNTR 543
gi 130469  466 AQGWGPITHDM--PESSDQRPYCWHYAPRPCGIVPASQVCGPVYCFTPSPVVVGTTDRFGAPTYSWGENETDVLLLSNTR 543
gi 266821  466 DQGWGPITYTE--ADIQDQRPYCWHYAPRPCGIVPASQVCGPVYCFTPSPVVVGTTDRFGAPTYSWGENETDVLILNNTR 543
gi 130458  466 DQGWGPITYAE--SSRSDQRPYCWHYPPPQCTIVPASEVCGPVYCFTPSPVVVGTTDRFGVPTYRWGENETDVLLLNNTR 543
gi 130461  466 AQGWGPISYAN--GSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTR 543
gi 130455  466 DQGWGPISYAN--GSGPDQRPYCWHYPPKPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGENDTDVFVLNNTR 543
gi 130467  466 RIGWGTLEYETnvTNEEDMRPYCWHYPPKPCGIVSAKTVCGPVYCFTPSPVVVGTTDRQGVPTYSWGENETDVFLLNSTR 545
gi 130465  466 RIGWGTLQYEDnvTNPEDMRPYCWHYPPKPCGIVPARSVCGPVYCFTPSPVVVGTTDARGVPTYTWGENETDVFLLNSTR 545
gi 130466  466 RVGWGALQYEDnvTNPEDMRPYCWHYPPRQCGVVSASSVCGPVYCFTPSPVVVGTTDRLGAPTYTWGENETDVFLLNSTR 545
                      170       180       190       200       210       220       230       240
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130468  546 PPRGAWFGCTWMNGTGFTKTCGAPPCRIRKDYNSTidLLCPTDCFRKHPDATYLKCGAGPWLTPRCLVDYPYRLWHYPCT 625
gi 266820  544 PPQGNWFGCTWMNSTGFTKTCGGPPCNIGGVGNLT--LTCPTDCFRKHPEATYTKCGSGPWLTPRCIVDYPYRLWHYPCT 621
gi 130469  544 PPQGNWFGCTWMNSTGFTKTCGGPPCNIGGVGNNT--LVCPTDCFRKHPEATYTKCGSGPWLTPRCMVDYPYRLWHYPCT 621
gi 266821  544 PPQGNWFGCTWMNSTGFTKTCGGPPCNIGGGGNNT--LVCPTDCFRKHPEATYTKCGSGPWLTPRCMVDYPYRLWHYPCT 621
gi 130458  544 PPQGNWFGCTWMNSTGFTKTCGGPPCNIGGVGNNT--LTCPTDCFRKHPEATYTKCGSGPWLTPRCMVDYPYRLWHYPCT 621
gi 130461  544 PPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNT--LLCPTDCFRKYPEATYSRCGSGPRITPRCMVDYPYRLWHYPCT 621
gi 130455  544 PPLGNWFGCTWMNSTGFTKVCGAPPCVIGGAGNNT--LHCPTDCFRKHPDATYSRCGSGPWITPRCLVDYPYRLWHYPCT 621
gi 130467  546 PPRGAWFGCTWMNGTGFTKTCGAPPCRIRRDYNGTldLLCPTDCFRKHPDTTYLKCGAGPWLTPRCLVDYPYRLWHYPCT 625
gi 130465  546 PPRGSWFGCTWMNSTGFTKTCGAPPCRIRADFNAStdLLCPTDCFRKHSDATYIKCGSGPWLTPKCMVDYPYRLWHYPCT 625
gi 130466  546 PPQGSWFGCTWMNSTGYTKTCGAPPCRIRADFNASmdLLCPTDCFRKHPDTTYIKCGSGPWLTPRCLIDYPYRLWHYPCT 625
                      250       260       270       280       290       300       310       320
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 130468  626 VNFTIFKARMYVGGVEHRFSAACNFTRGDRCRLEDRDRGQQSPLLHSTTEWAVLPCSFSDLPALSTGLLHLHQNIVDVQY 705
gi 266820  622 VNFTIFKVRMYVGGVEHRLSAACNWTRGERCDLEDRDRSELSPLLLSTTEWQTLPCSFTTLPALSTGLIHLHQNIVDVQY 701
gi 130469  622 VNFTVFKVRMYVGGVEHRLNAACNWTRGERCDLEDRDRSELSPLLLSTTEWQILPCSFTTLPALSTGLIHLHRNIVDVQY 701
gi 266821  622 VNFTIFKVRMYVGGVEHRLNAACNWTRGERCDLEDRDRSELSPLLLSTTEWQILPCSFTGLPALSTGLIHLHQNVVDVQY 701
gi 130458  622 VNFTIFKVRMYVGGVEHRLNAACNWTRGERCDLEDRDRPELSPLLLSTTEWQVLPCSFTTLPALSTGLIHLHQNIVDVQY 701
gi 130461  622 INYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQY 701
gi 130455  622 INYTIFKIRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLTTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQY 701
gi 130467  626 VNFTIFKVRMYVGGVEHRLDAACNFTRGDRCRLEDRDRSQQSPLLHSTTEWAVLPCSYSDLPALSTGLLHLHQNIVDVQY 705
gi 130465  626 VNYSIFKIRMYVGGVEHRLTAACNFTRGDPCNLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQY 705
gi 130466  626 VNYTIFKIRMYVGGVEHRLTAACNFTRGDRCNLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQF 705
                      330       340
               ....*....|....*....|....*...
gi 130468  706 LYGLSPALTRYIVKWEWVILLFLLLADA 733
gi 266820  702 LYGIGSAVVSFVIKWEYIVLLFLLLADA 729
gi 130469  702 LYGIGSAVVSFAIKWEYILLLFLLLADA 729
gi 266821  702 LYGIGSAVVSFAIKWEYILLLFLLLADA 729
gi 130458  702 LYGIGSAVVSFAIKWEYVLLLFLLLADA 729
gi 130461  702 LYGVGSSIASWAIKWEYVVLLFLLLADA 729
gi 130455  702 LYGVGSSIASWAIKWEYVVLLFLLLADA 729
gi 130467  706 LYGLSPAITRHIVKWEWVILLFLLLADA 733
gi 130465  706 MYGLSPALTKYVVRWEWVVLLFLLLADA 733
gi 130466  706 MYGLSPALTKYIVRWEWVVLLFLLLADA 733
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap