Conserved Protein Domain Family
SDH_sah

?
pfam01972: SDH_sah 
Serine dehydrogenase proteinase
This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily. The family has a catalytic triad of Ser, Asp, His residues, which shows an altered residue ordering compared with the ClpP proteinases but similar to that of the carboxypeptidase clan.
Statistics
?
PSSM-Id: 110924
View PSSM: pfam01972
Aligned: 4 rows
Threshold Bit Score: 474.334
Threshold Setting Gi: 2496184
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81343538   1 MPYYDPFSY-LFSLLWFLLFVFILLSPWYKRMALIKAREDVIRKLEEKRKSRVITMIHRQEQIGFLGIPIFRFMTIEDSE 79
gi 2495823    3 GEKMDPLSGfISSLIWWLLFFYLIMAPQIQYKQLQLARLKILRELSNKRNSTVITMIHRQESIGLFGIPVYKFITIEDSE 82
gi 74513486   7 VTYSDPMAS-LSGLFWILLFLYLIFAPQLKHQQLLAARRRAMRRIGMKRGSNVITMIHRQESIGFLGIPIYRFIDIDDSE 85
gi 2496184    9 KIMGDEMTS--MDMFFFLFIFLLFIYPEMMMRYRIMKRLRCIREIERQRGTRVIAMIHRQEALTFLGIPIYKFITIEDSE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81343538  80 RVLRAIRMTPDDMPIDLIIHTPGGLALAATQIANALVKHKAPVRVIVPHYAMSGGTLIALAADEIIMDENAVLGPVDPQI 159
gi 2495823   83 EILRAIRAAPKDKPIDLIIHTPGGLVLAATQIAKALKAHPAETRVIVPHYAMSGGTLIALAADKIIMDENAVLGPVDPQL 162
gi 74513486  86 KVLRAIRSTPKDKPIDLIIHTPGGLVLAATQIAKALHDHPAKTTVIVPHYAMSGGTLIALAADEILIDPHAVLGPVDPQL 165
gi 2496184   87 EILRAIRLTPEDMPIDLIIHTPGGLALASEQIALALKEHKAKTTVIIPHYAMSGGSLIALAADEIIMDKNAVMGPVDPQI 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81343538 160 GNMPAASILKVLEKKDPKDIDDQTLIMADVSEKAIKQMVDCLVDLLtKNGMDKEKAKKIAEELATGKFTHDYPLTVEYLK 239
gi 2495823  163 GQYPAPSIVKAVEQKGADKADDQTLILADIAKKAINQVQNFVYNLL-KDKYGEEKAKELSKILTEGRWTHDYPITVEEAK 241
gi 74513486 166 MNYPAPSILKVVEKKEPKDIDDKTLIMADIAEKAINQVRETVFNLL-KDKMDEEKAREVAKILTEGRWTHDYPLTVEELR 244
gi 2496184  167 GQYPAASILEAYYRKG-EKVSDETLILVDISKKAIKQMEEFVYELL-KDKYGDEKAKEIAKKLTSGTWTHDYPLTVSKLK 244
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*....
gi 81343538 240 SLGLPVNTNVPQEVYELMELYEQPMGSQPPsVQYIPVPYKspqQQQNAK 288
gi 2495823  242 ELGLDVDTNVPEEVYTLMELYKQPVRQRGT-VEFMPYPVK---QENGAK 286
gi 74513486 245 QLGLKVSTDVPEEVYELMELYPQPMMQRHPgVEFVPSPPK---GEKPSF 290
gi 2496184  245 ELGIEVNTNVPRKVYELLELYPQPMGAKPS-VYYIPVPYSkkeSEKNAK 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap