Conserved Protein Domain Family
Gallidermin

?
pfam02052: Gallidermin 
Gallidermin
Statistics
?
PSSM-Id: 110996
View PSSM: pfam02052
Aligned: 3 rows
Threshold Bit Score: 87.0331
Threshold Setting Gi: 757196138
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|..
gi 20138542  12 TETFDVQEDLFAFDTTDTTIVASNDDPDTRFKSWSLCTPGCARTGSFNSYCC 63
gi 125971     1 MEAVKEKNDLFNLDVKVNAKESNDSGAEPRIASKFICTPGCAKTGSFNSYCC 52
gi 757196138  1 MEAVKEKNELFDLDVKVNAKESNDSGAEPRIASKFLCTPGCAKTGSFNSYCC 52
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap