Conserved Protein Domain Family
SURF4

?
pfam02077: SURF4 
SURF4 family
Statistics
?
PSSM-Id: 111019
View PSSM: pfam02077
Aligned: 6 rows
Threshold Bit Score: 347.848
Threshold Setting Gi: 1723786
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6094373   33 SERACQFMEQAE-TFMAPFTPYMPLLGRFLIVATYFEDAIRIVTQWPEQVSYMRDYRRFRFGTAPLLLFVCVVLMLVGST 111
gi 6094371    5 NEYIAKTEDVAE-QVIKRGKNVLPTVARLCLIATFFEDGLRMYIQWNEQREYMDMSWGCGKFLATVFVLVNLLGQLGGCG 83
gi 12644052   4 NDLMGTAEDFAD-QFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCV 82
gi 2833297   11 NEMLAKAEDAAE-DFFRKTRTYLPHIARLCLVSTFLEDGIRMYFQWDDQKQFMQESWSCGWFIATLFVIYNFFGQFIPVL 89
gi 6136701    4 NVVITRCEDYTE-TLARNTRKVLPTIGRLLLISTFVEDGLRLLFNTHDHVNHFSYNWGLNYHFSLFLTIVMIINLLFGSL 82
gi 1723786   48 EKFASRIEGLTDnAVVYKLKPYIPSLSRFFIVATFYEDSFRILSQWSDQIFYLNKWKHYPYFFVVVFLVVVTVSMLIGAS 127
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6094373  112 LVVFKKRQAYAIGSLLFVTLLQAFAYGLITSGEMFFRNMSVIGGLCLVASDTFIHRRIn-RFAGLPAVSE--HNKRTYFQ 188
gi 6094371   84 MVMARFKVDIAVGLLFFIVVLQTVAYSILWDFQFLLRNFALIGALLLVLAEARIEGRS--LFAGVPSMGE--NKPKNFMQ 159
gi 12644052  83 LVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKS--MFAGVPTMRE--SSPKQYMQ 158
gi 2833297   90 MIMLRKKVLVACGILASIVILQTIAYHILWDLKFLARNIAVGGGLLLLLAETQEEKAS--LFAGVPTMGDs-NKPKSYML 166
gi 6136701   83 FVMMRYKVTESSAVLGFTIFAQVILYQLYTTYHLLTRNISIVAAIMLLVAENMLRKPKpaNYTQLPRDEHe-IEVTSVLL 161
gi 1723786  128 LLVLRKQTNYATGVLCACVISQALVYGLFTGSSFVLRNFSVIGGLLIAFSDSIVQNKT--TFGMLPELNSknDKAKGYLL 205
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6094373  189 LAGRVLLIFMFLGLLAKEgsgISWTRILVHILSVTACAMVVIGFKAKFFAAVLVLILSVANFIINSFWSVPRESPYRDFY 268
gi 6094371  160 LAGRILLAFMFITLIRFE---LSVWQVIQDIIGSILMVLVVLGYKTKLSALILVALLTILNLYHNAWWTIPSYKPLRDFL 236
gi 12644052 159 LGGRVLLVLMFMTLLHFD---ASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFL 235
gi 2833297  167 LAGRVLLIFMFMSLMHFE---MSFMQVLEIVVGFALITLVSIGYKTKLSAIVLVIWLFGLNLWLNAWWTIPSDRFYRDFM 243
gi 6136701  162 AACRVCLNLMLISMVHFD---MSYTRILLCIISYGMMIFVWLGFKTRMMSFMLATWLFAYNIVLNDFWN--KDAELH-II 235
gi 1723786  206 FAGRILIVLMFIAFTFSK----SWFTVVLTIIGT---ICFAIGYKTKFASIMLGLILTFYNITLNNYWFY--NNTKRDFL 276
                       250       260       270
                ....*....|....*....|....*....|....
gi 6094373  269 RYDFFQTLSIVGGLLYLVNTGPGKFSVDEKKKIY 302
gi 6094371  237 KYDFFQTLSVIGGLLMIVSLGPGGVSMDEHKKKW 270
gi 12644052 236 KYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 269
gi 2833297  244 KYDFFQTMSVIGGLLLVIAYGPGGVSVDDYKKRW 277
gi 6136701  236 RYDFFQTLSAIGGLLLLIHTGPGEFSFDELKKKW 269
gi 1723786  277 KYEFYQNLSIIGGLLLVTNTGAGELSVDEKKKIY 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap