Conserved Protein Domain Family
7TM_GPCR_Sra

?
pfam02117: 7TM_GPCR_Sra 
Serpentine type 7TM GPCR chemoreceptor Sra
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Sra is part of the Sra superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 111054
View PSSM: pfam02117
Aligned: 10 rows
Threshold Bit Score: 422.906
Threshold Setting Gi: 44889060
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2500865    6 ANSSKCATEDQMILQTSLLLRINVIIMTIVAIITFILTYKALFILKIRPIFHSSTKILLYTSLLFVNVHAVIFMVIQNTA 85
gi 1176648    1 MSSQKCASHLEIARLESLNFKISQLIYFVLIITTLFFTFFALKVIQKKCIFQLSTKILLYQNLFSANIHQIFLGITIVER 80
gi 1176652    1 MSAPNCARKYDIARLSSLNFQISQYVYLSLISLTFIFSYFAVKIVHQKSIFQLSTKILLFHNLVSANLHQLLYLFSALRR 80
gi 1176649    1 MSLTKCASKLEIDRLISLNFRINQIIVLIPVFITFIFTYYAIKVVQKKSIFELSTKFLLIQNFFSANLHQVLYAIETIRR 80
gi 1176644    1 MSNITSASAAQIDHASSWNFRFAVFCSQLSIISTFILSVIAVKWIFTKSTFQTSTKIILVFNFVYANIHQFMYAIISLGM 80
gi 44889060   3 TNNPVCASDAHMEMYSSKLYTSALFLNLIIATTSMILTGFAIQKLFMESIINISTRMFLFCGLMCCSLHQTAYIVLRIQV 82
gi 1176655    1 MATIACASIIEQQRLRSSNFVIAQYIDLLCIVITFVTTYPAIQLVLNKSLFQWSTKMLILESLFFANLYQIFYGIEAITI 80
gi 1176653    1 MENLTCASSVEQDRFASLNFIISQSVDLITSFFTYMLSIIAIKMVLKQSIFETSTKILLFLNIFYANLYQIVYSIDVVVI 80
gi 1176651    1 MSNLSCAAPDVLERLDSFNMKLSQFVDLLAIILAFFASYFAIKIVINQSFFELSTKILLLQNLFYTNLYQISYGIEAIGM 80
gi 1176647    1 MSNSSCADEDLIIRFDSLNQKAAQFVYLLAIILTFITTYFAVKILFTQSFFEISTKILLVQNLFYANLYQFFHGIEAVRM 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2500865   86 LIRSFTLSDKPCEIMRTTLECRFQNHVLIFGIAGVNFNQFGLTVDRLLATIIPQSYSHMGALPGVILSVLVVACSIAAPL 165
gi 1176648   81 LNIAFFKLNDKCIPLRPETNCQLYLEMFIAGLSGMVYGQTGLLFERACATFIKKYEKRKSLATGIITSIIVLLLSGSTAR 160
gi 1176652   81 LNLAYFYIDEPCVPLISEADCLPYLKVLVTGISGMIYGQTGLLLERGCATFIKDYDKKTSMFVGIAISIAILFLSLITGK 160
gi 1176649   81 LHISLFETNQPCIPLKTEFECRLYLEVFVSGVAGMVYGQTGLLLERACATFIKNYEEKKSVRTGLAISVSVLCLSFITSR 160
gi 1176644   81 AYKGIFLLDETCEWLITEKDCLLYTEVLYVGISGMIYSQTGILIERAFATLYRNYTAKISRLVGIIISTFVLIMSIATYQ 160
gi 44889060  83 IYQVFFKLSEPCNLYYPAIDCKYVTFSLVAGNTGMIFIQSAMTIDRIFATIFPKLWPKLKYWPGVVLSILMIACNYANVQ 162
gi 1176655   81 LYKHHFMTSDFCNIMQTESNCAPYLKVILGTTGGMIFAQTGLMIERTCATFLASYRKRKSEIIGFSITIIVFFCSSITGK 160
gi 1176653   81 LYKHFFMQEEVCSLLILESSCAPFLETLIGTSSGMMYCQTGLLIERFCATFLKTYNGKKTIFVGSFIAIVVMISTTSTGK 160
gi 1176651   81 LYRGFFMLSEPCSILQSETSCAPYFKVLMIGTSGMIFGQTGLLIERAFATFATTYKTKKSVYIGVCISLIVLVCSTSSGF 160
gi 1176647   81 LYKSFFMINDPCNFMEPEIECVFYYKIILMGSSGMVYGQTGLLIERLCATFSKDYKKKQSAIKCAVISILVLICSSSTGR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2500865  166 IIAIGDPYDDIVPNCFFFPEHSAPRANIFLVTLSTLVITSIFLNFIIIYANKKLEKgcRTRFYVTQRYQKREALISTRII 245
gi 1176648  161 IIIWDDPLSEYQLACTSWPSKSRDRSTMFFSICTFISLFNLVISLLIRRHNEKLEY--STPFVVGPRFRKREVIDSTSTI 238
gi 1176652  161 IIIWDDPLQGYLLSCVSYPSQSVERSRLFASIYTFISSFNLVFSVLLRRYNKKLEY--STPFVVGPRFRKREVIDSTSTI 238
gi 1176649  161 LIIWDDPLDGYQLTCISFPSDSVDRSSYFQSICTLLALFNLVTSILIWKYNKKFEY--STPFVVGPRFRKREVIDSTSTI 238
gi 1176644  161 IIISDDPLEGVVLSCFVPAQHSAQRANTFLFIALILTFVNLISSAAVMFYNKRLEY--SIRYKVRERFKKREAIYSTHTI 238
gi 44889060 163 IIFWGDPLTEYVPTCGQFPSKSVNRFQTFLAIALYMSIAHMVINVIILYINVLQDRqqSKSFNVNQRYQSREALKSSQAI 242
gi 1176655  161 LFIWDDPLDGMVLGCFILPKNSYKRYNTYFTVCTVLPLFNLGISILLKIYNTKLEY--SSRFEVSARFQKREVIDSTGTV 238
gi 1176653  161 LVIWDDPLDDAVLACFIFPKKSKARSTIHFYISTVVSLFNLAASVALNKYNKTLEY--QVRFKICARFHKRQVIESTETI 238
gi 1176651  161 IILWDDPLEGWTIGCFAVSKSVVPRFNLFSILSTVLTLFNLIVSIFIQRYNKRFEF--ETRFKVGARFQKQELIESTGAI 238
gi 1176647  161 LIVWDDPIDKYNFACYIPPKESYIRANHYFTMCAVLSTINFCISTFILKYNKRCEY--QTRFKVGARFQKQELIESTKAI 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2500865  246 SYIAASQFLGLTLYSTMVLTLRLHK--SMIPISIYHNMVWWAYTVPFAAVSLPALLIYRINQVGSNRKRVINRITAKVET 323
gi 1176648  239 CFLTFFQFIFMFIYSFGVFLLGTIR--EIIGYEQYYFWVVWVYTIPFIAASFPILLIYRIRYSNTNRIMIIKQFTSTKQT 316
gi 1176652  239 CFLTFVQFIFMFIYSFGIFTLKTIR--SMLTYRQYYFIVVWFYTIPFIAALFPILLVYRIRSSHVSRVTIIKTFTKTKQT 316
gi 1176649  239 CFLTFVQFIFFLVYSLGFFIIKSIR--EIISYENYYLVAVWLYTPPYIAASFPILIFYRIRSSYANRVLIIKKFTNTKQT 316
gi 1176644  239 CVVCMAQFVTMLVYSSGVLILRCNM--SNILLTTFYKLITWVYTVQYNALLFPLILIFRIRATKLSRTKKIQDITSANQS 316
gi 44889060 243 FFLSMSQFFACLIYSVFTKVFLEFQ--LNLSPLQSGLVLALSYTTPYACIAIPSLIIFTFRFIKNQRLRNINELRSQTET 320
gi 1176655  239 CFLAFSLFILLFIYSVGVGALRHLLheNIISQEDFNLCVVWLYTIPFIAMLLPLLLIYRIRRTRSNRIEMLIEFTKQKQS 318
gi 1176653  239 CFLNFTQFVFMFIYSSGNSTLKSIR--DYIQPETYNFWVVWCYTVPFIALTFPLLLIYKVKSTRGIRAQKIVQISNTKQT 316
gi 1176651  239 CFLALSQFLWMFMYSFGILILRIIR--EDILPSTFYFWIAWCYTMPFIALMFPVLLIYRIRKTRARRTEKMKGITTEKQT 316
gi 1176647  239 CFLTVSQFVAVFLNSFGMIVLVYIQ--ESISHRIFNLLVVWLYAFPIVVLMFPVILVHQIRSSRWRRALKIKVIKNEKQT 316
                       330
                ....*....|..
gi 2500865  324 QEEHMKSLKELW 335
gi 1176648  317 QEDHIKQMKNVW 328
gi 1176652  317 QEEHIKQLKNVW 328
gi 1176649  317 IEEHIQQMKNAW 328
gi 1176644  317 QTEHYNQITSAW 328
gi 44889060 321 GDECMRKIAKIW 332
gi 1176655  319 QENHISQMKNMW 330
gi 1176653  317 QDEHINQMKVMW 328
gi 1176651  317 QDDHIKQINAMW 328
gi 1176647  317 QDDHMKHMKNMW 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap