Conserved Protein Domain Family
7TM_GPCR_Srb

?
pfam02175: 7TM_GPCR_Srb 
Serpentine type 7TM GPCR chemoreceptor Srb
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srb is part of the Sra superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 111105
View PSSM: pfam02175
Aligned: 3 rows
Threshold Bit Score: 280.546
Threshold Setting Gi: 52001260
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74964993  17 YHPFYMIAQFWSFFVSLLAMPSLIFFMVEKVFKLPFHGNLKFLLVSYFIGTFLFASIICFTFGYHFFVPFFVTSNCDLII 96
gi 52001260  27 FHPVYRVAQIYQFLVACFAFPPLFYFIFFKLIKSSFHGNLKCVLIGYFVTVLAFTINFQIVGFVQVLLPFISRTPCDLII 106
gi 74964994  17 FNTVYRFSQFYTFSVSSFAVPGLIYFMFKRLFQLYFHGNLKTLLIAYFISILLYAVMLCFAFGYQFFVPFFIKSNCDLII 96
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74964993  97 NATLFKYGHMIALIFMTIPMILPTAFTVERFVALKMAHSYEHVRTLLGPVLVLVVIAIDSMFLYDIYGQEKFDKPFINFI 176
gi 52001260 107 NGRYLKYGHPTGSFIMTLSTLLPICITIERFFAMKNAETYEKTPVKLGPIITFLLIIIDLTTVSMIHRNSNFDAGSISFV 186
gi 74964994  97 NKTLFKYIHTSVIFLLTTPMMFPLGFSIERFTAMAMASRYENIRTLIGPVLVIFLIIPNCIIFYFLFQHETYDDTFISFL 176
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 74964993 177 LVPATSA-LQFNSFLWYMLYLKITNFICNLILLFIHKILHQryrrKNVSLSVKYEMQEISQSSRFTLIVTFTHLLFF 252
gi 52001260 187 IFPSLEVgLTMMKFFIIIVIFNVINFLFNIKLIRDNAKLKS----INSTLSTKFQLEEVYFSTMFVITVVFYHVAFF 259
gi 74964994 177 MLPNTTA-VNFNTYLWFLLYLNIGNLALNVLLLLVHRKFKRrlllHKTSLSTRYAIEEISQSSKFTLIITFTHLLFF 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap