Conserved Protein Domain Family
Acyl_transf_2

?
pfam02273: Acyl_transf_2 
Click on image for an interactive view with Cn3D
Acyl transferase
This bacterial family of Acyl transferases (or myristoyl-acp-specific thioesterases) catalyze the first step in the bioluminescent fatty acid reductase system.
Statistics
?
PSSM-Id: 111194
View PSSM: pfam02273
Aligned: 4 rows
Threshold Bit Score: 547.118
Threshold Setting Gi: 738905198
Created: 16-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1THT_B         6 KTIAHVLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFAGLAEYLSTNGFHVFRYDSLHHVGLSSGSIDEFT 85
gi 126519      8 LPIDHVIDIGDNRYIRVWETKPKNKETKRNNTIVIASGFARRMDHFAGLAEYLANNGFRVIRYDSLNHVGLSSGEIKQFS 87
gi 738905198   8 VPIDHVIKVDNERHIRVWETFPKNQCDKRNNTIVIASGFARRMDHFAGLAEYLSTNGFHVIRYDSLNHVGLSSGEIDQFS 87
gi 506314873   8 KTIDHVICVEENRKIHVWETLPKENSPKRKNTLIIASGFARRMDHFAGLAEYLSQNGFHVIRYDSLHHVGLSSGTIDEFT 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1THT_B        86 MTTGKNSLCTVYHWLQ-TKGTQNIGLIAASLSARVAYEVISDLELSFLITAVGVVNLRDTLEKALGFDYLSLPIDELPND 164
gi 126519     88 MSVGKHSLLTVIDWLK-ERNINNIGLIASSLSARIAYEVAAEIDLSFLITAVGVVNLRSTLEKALKYDYLQMEVNTIPED 166
gi 738905198  88 MSVGKKSLLTVIDWLKsEHGIDQVGLIASSLSARIAYDIVADVNLSFLITAVGVVNLRNTLEQALKYDYLQMEIDEIPED 167
gi 506314873  88 MSIGKQSLLAVVDWLN-TRKINNLGMLASSLSARIAYASLSEINVSFLITAVGVVNLRYTLERALGFDYLSLPIDELPDN 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1THT_B       165 LDFEGHKLGSEVFVRDCFEHHWDTLDSTLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTGHCKLYSLLGSSHDLG 244
gi 126519    167 LIFEGHNLGSKVFVTDCFENNWDSLDSTINKICELDIPFIAFTSDGDDWVCQHEVKHLVSNVKSDKKKIYSLVGSSHDLG 246
gi 738905198 168 LDFDGYNLGSKVFVTDCFENNWDTLDSTINKTKNLNVPFIAFVANDDSWVQQHEVEELMSNINSDKTKIYSLIGSSHDLG 247
gi 506314873 167 LDFEGHKLGAEVFARDCFDSGWEDLTSTINSMMHLDIPFIAFTANNDDWVKQDEVITLLSSIRSHQCKIYSLLGSSHDLG 246
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*
1THT_B       245 ENLVVLRNFYQSVTKAAIAMDGGSLEIDVDFIEPDFEQLTIATVNERRLKAEIEN 299
gi 126519    247 ENLVVLRNFYQSMTKAAVSLDRQLVELVDEIIEPNFEDLTVITVNERRLKNKIEN 301
gi 738905198 248 ENLIVLRNFYQSITKAAIALDSNLVGLVSEIIEPQFEALTIATVNERRLKNKIQS 302
gi 506314873 247 ENLVVLRNFYQSVTKAAIAMDNGCLDIDVDIIEPSFEHLTIAAVNERRMKIEIEN 301
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap