Conserved Protein Domain Family
MerT

?
pfam02411: MerT 
MerT mercuric transport protein
MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerE).
Statistics
?
PSSM-Id: 111318
View PSSM: pfam02411
Aligned: 3 rows
Threshold Bit Score: 170.821
Threshold Setting Gi: 75342506
Created: 14-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75342506    1 MSEpKTVRGALFAGGLAAMLASTCCLGPLILVTLGISGAWIGNLAALEPYRPFFIAAALVALFFAWRRIYRPVHAYTQGA 80
gi 2498550     1 MSK-SNPNFPIIGGVIAAIGAGLCCAGPFVLLLLGVSGSWIGNLTLLEPYRPIFILLVLALFGFAGWKVYRPVEDCEPGT 79
gi 447217403   1 MSEpQNGRGALFAGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGAALVALFFAWRRIVRPTAACKPGE 80
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 75342506   81 VCSMPQVRRTYKPVFWIVVALILVAIAFPYVLRLFY 116
gi 2498550    80 SCAVPQVRKRRQVIFWLTALTALVLVTSNYWIVWFA 115
gi 447217403  81 VCAIPQVRTTYKLIFWFVAVLVLVALGFPYVMPFFY 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap