Conserved Protein Domain Family
UPF0060

?
pfam02694: UPF0060 
Uncharacterized BCR, YnfA/UPF0060 family
Statistics
?
PSSM-Id: 111577
View PSSM: pfam02694
Aligned: 4 rows
Threshold Bit Score: 133.36
Threshold Setting Gi: 3183475
Created: 17-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 614094753   2 VVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPdAHFGRVLAAYGGVFVAGSLAWGMALD 81
gi 3183239     2 ILRSLLYFVMAGLCEIGGGYLVWLWIREGKSVWLALVRAILLTVYGFVATLQP-ANFGRAYAAYGGIFIILSIIWGWQVD 80
gi 3183433     2 MLITILLFLAAGLAEIGGGYLVWLWLREAKPAGYGIAGALILIVYGILPTFQSfPSFGRVYAAYGGVFIVLAVLWGWLVD 81
gi 3183475     1 MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHP-AASGRVYAAYGGVYVCTALMWLRVVD 79
                         90       100
                 ....*....|....*....|....*....
gi 614094753  82 GFRPDRWDVIGALGCMAGVAVIMYAP-RG 109
gi 3183239    81 NVVVDRLDWLGAAIALVGVLVMMYAN-RA 108
gi 3183433    82 RKTPDLYDWIGAFICLIGVCVILFAP-RG 109
gi 3183475    80 GVKLTLYDWTGALIALCGMLIIVAGWgRT 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap