Conserved Protein Domain Family
LEA_4

?
pfam02987: LEA_4 
Late embryogenesis abundant protein
Different types of LEA proteins are expressed at different stages of late embryogenesis in higher plant seed embryos and under conditions of dehydration stress. The function of these proteins is unknown.
Statistics
?
PSSM-Id: 111833
View PSSM: pfam02987
Aligned: 26 rows
Threshold Bit Score: 32.2805
Threshold Setting Gi: 119127
Created: 17-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....
gi 75101372  202 KDYAAEKAKEAKDKTVGKASEYKDYAAEKAKETKDSALGKAEEY 245
gi 75102152  297 AEATANKAGEMKEATKKKTAETAEAAKNKAGEIKDRAAETAEAA 340
gi 75102152  348 AEVTKNKALEMKDAAKDRTAETTDAAKQKTAQAKENTKENVSGA 391
gi 122096692 252 KEAAKDKIGHAVDVTTDKLGQAKDATAEKLVQAKDATAEKLGYA 295
gi 122096692 413 KDKTADKLGQAADKTKEKLVEAKDVTADKLGHAKDVTADKLGRA 456
gi 75216114  322 KDYAYKKAGNAKDIAYEKAQDAKDFAYDKAGYGYDKAGDVIRMA 365
gi 75216114  238 MDSGYDKAGDAKDMAYEKAGIVKDMAYDKAGDAKDVAYEKAGIA 281
gi 75216114   77 ENYAYDKANYVKDSAYDNAGYAKDFAENKAEYAKDFAYDKAGDA 120
gi 75383489   15 KDTVADKAKELKDEAVTKVGELKDKATEKAGELKDKVVDKAKEL 58
gi 75101372   78 TEETAESTRESGENAAEKARKTKDSAAEKTRETKKCAAEKAKEY 121
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap