Conserved Protein Domain Family
CBM_19

?
pfam03427: CBM_19 
Carbohydrate binding domain (family 19)
Statistics
?
PSSM-Id: 112252
View PSSM: pfam03427
Aligned: 2 rows
Threshold Bit Score: 93.6099
Threshold Setting Gi: 116306
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60
              ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 116306 338 TTTTAAPTATSAPGSCPVANQSCSTQNQYACTADGKYAVCDHGKWVVSSCPSGTVCIPTTD 398
gi 116305 330 ITTTSLATASSALFPLLYAGRSCSSQSKVSCTSTGSYTICNYGKWVTAPCPPGVICLSSAQ 390
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap