Conserved Protein Domain Family
Spuma_A9PTase

?
pfam03539: Spuma_A9PTase 
Spumavirus aspartic protease (A9)
Statistics
?
PSSM-Id: 112362
View PSSM: pfam03539
Aligned: 4 rows
Threshold Bit Score: 306.39
Threshold Setting Gi: 82305306
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82279696    11 IKGNHLKGYWDSGAEITCVPAIYIIEEQPVGKKLITTIHNEKEHDVYYVEMKIEKRKVQCEVIATALDYVLVAPVDIPWY 90
gi 82305306    11 IKGNSLKGFYDTGAEITCVPAIFLIEEEPIGERTIQTIHGITKEKVYYLTFKIQGRKLAAEVIGTQLDYVIIAPSDIPWY 90
gi 110282985   14 IKGTKLKAHWDSGATITCVPEAFLEDERPIQTMLIKTIHGEKQQDVYYLTFKVQGRKVEAEVLASPYDYILLNPSDVPWL 93
gi 82281205    11 RKGVKIKGYWDSQADITCVPKDLLQGEEPVRQQNVTTIHGTQEGDVYYVNLKIDGRRINTEVIGTTLDYAIITPGDVPWI 90
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82279696    91 KPGPLELTIKIDVESQKHTLITESTLSPQGQMRLKKLLDQYQALWQCWENQVGHRRIEPHKIATGALKPRPQKQYHINPR 170
gi 82305306    91 KKYELELTIKIDIQKQQEQLLHTTNLSSEGKKYLKDLFIKYDNLWQKWENQVGHRRITPHKIATGTLNPKPQKQYRINPK 170
gi 110282985   94 MKKPLQLTVLVPLHEYQERLLQQTALPKEQKELLQKLFLKYDALWQHWENQVGHRRIKPHNIATGTLAPRPQKQYPINPK 173
gi 82281205    91 LKKPLELTIKLDLEEQQGTLLNNSILSKKGKEELKQLFEKYSALWQSWENQVGHRRIRPHKIATGTVKPTPQKQYHINPK 170

                  ...
gi 82279696   171 AKA 173
gi 82305306   171 AKA 173
gi 110282985  174 AKP 176
gi 82281205   171 AKP 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap