Conserved Protein Domain Family
DUF334

?
pfam03904: DUF334 
Domain of unknown function (DUF334)
Staphylococcus aureus plasmid proteins with no characterized function.
Statistics
?
PSSM-Id: 112704
View PSSM: pfam03904
Aligned: 2 rows
Threshold Bit Score: 434.056
Threshold Setting Gi: 141194
Created: 16-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 141194   1 MALQSRNSDENEKKNENTMNMQTRSKLTGTHSQKIQKTLENEELQELKKQNKLVIKYISEMKEQQDLREKELQAIKSSLK 80
gi 141193   2 RKGQLIMSMKDIKNNKENPNTQMNSKSTGTPSSSTQNSLNNEELSELKRQNKLIVKYLAEIQENQKIREKEQKEITSELK 81
                      90       100       110       120       130       140       150       160
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 141194  81 KTTEDFQGRGKKVHNDFVRLLQKNLNRVNAEDIEIEVRKDVYGVREEIHSMLREVKQSHEHYQKRQKQLFTGIGAMLLVF 160
gi 141193  82 EATKDFRDKSLKIRNDFVDVLQEKLKHVDTEELKDILGRGIYKVREENDRMLQEVKRSHEHYQTRQKYLFTGIGAMLLVF 161
                     170       180       190       200       210       220
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 141194 161 MLFALIMTIGRDFMGFLHVDVLQNAIASKIKASEGFISVLWYIAYGLPYILAIGLFIWLYEWIRARFHD 229
gi 141193 162 MLFALIMTIGSDFMSFLHVDTLQNAIAGKLKASEGFMTFVWYIAYGLPYVLAIGLFIGLYEWIRAKFHD 230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap