Conserved Protein Domain Family
RRM_2

?
pfam04059: RRM_2 
RNA recognition motif 2
Statistics
?
PSSM-Id: 112856
View PSSM: pfam04059
Aligned: 4 rows
Threshold Bit Score: 193.546
Threshold Setting Gi: 126947
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75331393  743 RTTLMIKNIPNKYTSKMLLSAIDEHCKGTYDFLYLPIDFKNKCNVGYAFINLIEPEKIVPFFKAFNGKKWEKFNSEKVAT 822
gi 126947    596 RTTVMIKNIPNKFTQQMLRDYIDVTNKGTYDFLYLRIDFVNKCNVGYAFINFIEPQSIITFGKARVGTQWNVFHSEKICD 675
gi 334305801 612 RTTLMIKNIPNKYTRNMLLAAIDEKNSGTYDFLYLPIDFKNKCNVGYAFINMVSPKFTIALYEAFNGKKWDKFNSEKVAS 691
gi 75337307  679 RTTLIIKNIPNKYTYKMLVAEIDEKHKGDYDFLCLPTDFKNKCNMGHAFINMVSPLHIVPFQQTFNGKIWEKFNSGKVAS 758
                         90
                 ....*....|....*..
gi 75331393  823 LTYARIQGKTALIAHFQ 839
gi 126947    676 ISYANIQGKDRLIEKFR 692
gi 334305801 692 LAYARIQGKAALIAHFQ 708
gi 75337307  759 LAYAEIQGKSALASYMQ 775
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap